DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and GstE11

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster

Alignment Length:213 Identity:92/214 (43%)
Similarity:125/214 (58%) Gaps:2/214 (1%)


  Fly     3 KLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
            |..||....|||.|:||||..||.|:.|.::||:...||...||||:|..||:|.|||||..::|
  Fly     4 KPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSD 68

  Fly    68 SHAINSYLVSKYG--RNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQAR 130
            ||.|.|||..||.  .:|||||||.:||.:||.||:||...:....|.|..|:.:....|:|..|
  Fly    69 SHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDR 133

  Fly   131 IDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKELP 195
            :..|:..|..|...|..|:||.||.|||||...||.::....|.|::..::|.|..|:|||:.||
  Fly   134 VAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQALP 198

  Fly   196 YYEEANGSRAAQIIEFIK 213
            ||::.|......::..:|
  Fly   199 YYQKNNQEGLDMLVGLVK 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 86/193 (45%)
GST_N_Delta_Epsilon 4..77 CDD:239343 38/73 (52%)
GST_C_Delta_Epsilon 91..208 CDD:198287 43/117 (37%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 86/193 (45%)
GST_N_Delta_Epsilon 5..78 CDD:239343 38/73 (52%)
GST_C_Delta_Epsilon 94..211 CDD:198287 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134647768
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.