DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and GstE8

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster

Alignment Length:219 Identity:115/220 (52%)
Similarity:153/220 (70%) Gaps:1/220 (0%)


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            |.||.|||.:.|||||:..|||.||.:.::|..:|.:.||.|.||||:.||.||||.|:|:|.::
  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65

  Fly    66 ADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTG-RAITFPLFWENKTEIPQA 129
            .|||||::|||||||::|:||||||.:||:||||||::|.||...| |.||.|||...:|.||:.
  Fly    66 WDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKE 130

  Fly   130 RIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKEL 194
            |.||:..:|..:..||...:::|||.||||||.:|..:|...||:.:|..||..:.||||||:||
  Fly   131 RYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL 195

  Fly   195 PYYEEANGSRAAQIIEFIKSKKFT 218
            ||||||.|..|..::..:|...||
  Fly   196 PYYEEACGKGARDLVTLLKKFNFT 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 102/192 (53%)
GST_N_Delta_Epsilon 4..77 CDD:239343 40/73 (55%)
GST_C_Delta_Epsilon 91..208 CDD:198287 59/118 (50%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 102/192 (53%)
GST_N_Delta_Epsilon 4..77 CDD:239343 40/73 (55%)
GST_C_Delta_Epsilon 91..209 CDD:198287 59/118 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134647298
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_127168
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.