DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and GstE2

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster

Alignment Length:211 Identity:98/212 (46%)
Similarity:135/212 (64%) Gaps:0/212 (0%)


  Fly     3 KLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
            ||.|||:|.|||||:..|||||||||::||.::|:..:|.|..|||.||.||||.|:|||..:.|
  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD 68

  Fly    68 SHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARID 132
            ||||..|||.||..:|.|||:||..||.|||||.:|:|::..:.|.::.|.|....:.:|:.::|
  Fly    69 SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVD 133

  Fly   133 ALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKELPYY 197
            .::..|..|..||.:..||.|..|||||....|..:.....|.:|..|||::|||.:|:.:||:|
  Fly   134 NIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHY 198

  Fly   198 EEANGSRAAQIIEFIK 213
            ||.|.....:.|..:|
  Fly   199 EEDNLRGLKKYINLLK 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 90/191 (47%)
GST_N_Delta_Epsilon 4..77 CDD:239343 45/73 (62%)
GST_C_Delta_Epsilon 91..208 CDD:198287 42/117 (36%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 90/191 (47%)
GST_N_Delta_Epsilon 5..78 CDD:239343 45/73 (62%)
GST_C_Delta_Epsilon 94..209 CDD:198287 42/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134647227
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_127168
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.