DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and GstE1

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster

Alignment Length:213 Identity:105/214 (49%)
Similarity:145/214 (68%) Gaps:2/214 (1%)


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            :.|||.|.||.||:|.|||:.||||::||.|||...|||..|::|.||.||||.|||||.::.||
  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDS 70

  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWEN-KTEIPQARID 132
            |||.:|||.||.::|.||||||.|||||:|||.:|:||:.::...::.| ||.| .||:||.::|
  Fly    71 HAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRP-FWINGVTEVPQEKLD 134

  Fly   133 ALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKELPYY 197
            |:....|.|..||.|..|||||:||:||......::.....:.:|...||::.||:.|:.:||||
  Fly   135 AVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYY 199

  Fly   198 EEANGSRAAQIIEFIKSK 215
            :|.|.:.|...:.|::||
  Fly   200 KEINEAPAQSYVAFLRSK 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 96/192 (50%)
GST_N_Delta_Epsilon 4..77 CDD:239343 45/73 (62%)
GST_C_Delta_Epsilon 91..208 CDD:198287 48/118 (41%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 45/73 (62%)
GstA 8..197 CDD:223698 96/190 (51%)
GST_C_Delta_Epsilon 94..210 CDD:198287 48/117 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134647285
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_127168
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.