DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and GstT3

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster

Alignment Length:228 Identity:68/229 (30%)
Similarity:105/229 (46%) Gaps:51/229 (22%)


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLK-INPLHTVPALDDNGFYLADSHAINSYL 75
            |.|.|::.:..|..|:.|:..:|.|...|||..:|.| ||....||.:.|||:.||:|.||..||
  Fly    53 SQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYL 117

  Fly    76 VSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW-----------ENKTEI--- 126
            .:|....:.||||....::.||:.|.:....:..| .|:.|...|           |.|.|.   
  Fly   118 SAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLT-CAMYFRTVWLEPLLTGRTPSEAKIETFRM 181

  Fly   127 -PQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDAT---------KY 181
             .:..:|.:|.|:      ||..::|.|.:||:||         .|....::.|         ||
  Fly   182 QMERNLDVVEEVW------LEGKDFLTGSSLTVAD---------IFAACEIEQTRMADYDVRIKY 231

  Fly   182 PELAAWIKRIKEL--PYYEEANGSRAAQIIEFI 212
            |::.||:||:::.  |||:.|:        ||:
  Fly   232 PKIRAWLKRVRQSCNPYYDVAH--------EFV 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 62/210 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/66 (41%)
GST_C_Delta_Epsilon 91..208 CDD:198287 34/143 (24%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 28/68 (41%)
GstA 47..243 CDD:223698 62/206 (30%)
GST_C_Theta 135..259 CDD:198292 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92091939
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.