DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and LOC103694878

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_008772069.1 Gene:LOC103694878 RGDID:9417129 Length:71 Species:Rattus norvegicus

Alignment Length:56 Identity:18/57 (32%)
Similarity:31/57 (54%) Gaps:0/57 (0%)


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
            |.|.|:|.:..:...:.|..:.|:|::.:||..:|.::|.|..||.|.|..|.|.:
  Rat    11 SQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLTE 66

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 18/57 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/57 (32%)
GST_C_Delta_Epsilon 91..208 CDD:198287
LOC103694878XP_008772069.1 Thioredoxin_like 3..66 CDD:294274 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92109702
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.