DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE2 and GstD2

Sequence 1:NP_611324.1 Gene:GstE2 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:190 Identity:71/191 (37%)
Similarity:102/191 (53%) Gaps:2/191 (1%)


  Fly    17 RACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYLVDKYA 81
            |...:..:||.|:...|.::.:.|:..|..|:|.|||||:|.|.|||..||:|.||..|||:||.
  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77

  Fly    82 NSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIKDAYGHLENFL 146
            ..|.|.|.|...||.::|||:||...|:.|......|.| |.......|.:..|:.|:|.|:.||
  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLF-RTGKPGSDEDLKRIETAFGFLDTFL 141

  Fly   147 GDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYEEDNLRGL 206
            ....|:.|.|||:||:...:|.|:. .|.:.|..||..|:.|::...|:....::|..||
  Fly   142 EGQEYVAGDQLTVADIAILSTVSTF-EVSEFDFSKYSNVSRWYDNAKKVTPGWDENWEGL 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 68/179 (38%)
GST_N_Delta_Epsilon 5..78 CDD:239343 27/61 (44%)
GST_C_Delta_Epsilon 94..209 CDD:198287 38/114 (33%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 27/61 (44%)
GST_C_Delta_Epsilon 88..204 CDD:198287 38/116 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92093848
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.