DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE1 and GSTF5

Sequence 1:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana

Alignment Length:220 Identity:53/221 (24%)
Similarity:85/221 (38%) Gaps:31/221 (14%)


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            :||...|...|.|...|....|.|:...|||.||:.....::..||...||:..|.|..:.:|.|
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    73 IAAYLVDKYAKSDELYPKDLAKRAIVNQRLF-------FDASVIYASIANVSRPFW-------IN 123
            |:.|:...:...........:.:.:..||::       ||......:.....:|.:       :.
plant   131 ISEYIATVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMYGLKTDYKVV 195

  Fly   124 GVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPAT------ 182
            ..||...||:      |.:.|..|.||.:||.:|.|:|||...|.:..:     :|..|      
plant   196 NETEAKLEKV------LDIYEERLKNSSFLASNSFTMADLYHLPNIQYL-----MDTHTKRMFVN 249

  Fly   183 YPKVTAWLDRLNKLPYYKEINEAPA 207
            .|.|..|:..:...|.:|...:..|
plant   250 RPSVRRWVAEITARPAWKRACDVKA 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 23/71 (32%)
GstA 8..197 CDD:223698 50/209 (24%)
GST_C_Delta_Epsilon 94..210 CDD:198287 30/135 (22%)
GSTF5NP_001322019.1 PLN02473 65..268 CDD:166114 52/213 (24%)
GST_N_Phi 65..136 CDD:239351 23/70 (33%)
GST_C_Phi 153..270 CDD:198296 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.