DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE1 and GSTT2

Sequence 1:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana

Alignment Length:221 Identity:60/222 (27%)
Similarity:100/222 (45%) Gaps:32/222 (14%)


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            :|...:|...|.|.:..||..:.::...::|...:.||.|:.:.||...||.:.|....:::|||
plant     5 VYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFESHA 69

  Fly    73 IAAYLVDKYAK-SDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRP----FWINGV------- 125
            |..||...||. .|..||.||:|||.::       ||:.....|: ||    :.:|.|       
plant    70 ILIYLSSAYASVVDHWYPNDLSKRAKIH-------SVLDWHHTNL-RPGASGYVLNSVLAPALGL 126

  Fly   126 ---TEVPQEKLDAVHQGLKLLETF--LGNSPY-LAGDSLTLADLSTGPTVSAVPAAVDIDP---- 180
               .:...|..:.:...|..||||  .|::.: |.|...::||||....:..:....|.|.    
plant   127 PLNPKAAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLRLL 191

  Fly   181 ATYPKVTAWLDRLNK--LPYYKEINE 204
            :.:.||..|::...|  :|:..|::|
plant   192 SPHKKVEQWIESTRKATMPHSDEVHE 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/71 (30%)
GstA 8..197 CDD:223698 57/213 (27%)
GST_C_Delta_Epsilon 94..210 CDD:198287 32/135 (24%)
GSTT2NP_198940.3 GstA 3..202 CDD:223698 56/205 (27%)
GST_N_Theta 3..78 CDD:239348 21/73 (29%)
GST_C_Theta 92..221 CDD:198292 32/135 (24%)
NAM-associated 380..513 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.