DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE1 and GSTT1

Sequence 1:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana

Alignment Length:215 Identity:58/216 (27%)
Similarity:101/216 (47%) Gaps:20/216 (9%)


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            :|...:|...|.|.:..||..:.::...::|...:.||.|:...||...||.:.|....:::|||
plant     6 VYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKLFESHA 70

  Fly    73 IAAYLVDKY-AKSDELYPKDLAKRAIVNQRLFFD--------ASVIYASIANVSRPFWINGVTEV 128
            |..||...: :.:|..||.||:|||.::..|.:.        |..:..|:...:....:|.....
plant    71 ILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPLNPKAAA 135

  Fly   129 PQEKLDAVHQGLKLLETF--LGNSPYLAGDSL-TLADLSTGPTVSAVPAAVDIDP----ATYPKV 186
            ..|:|  :.:.|..||||  .||:.:|.|.:. ::||||....:..:....|.|.    :|:.||
plant   136 EAEQL--LTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLSTHKKV 198

  Fly   187 TAWLDRLNK--LPYYKEINE 204
            ..|::...|  :|::.|.:|
plant   199 EQWIENTKKATMPHFDETHE 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/71 (30%)
GstA 8..197 CDD:223698 55/207 (27%)
GST_C_Delta_Epsilon 94..210 CDD:198287 32/129 (25%)
GSTT1NP_198937.1 GstA 4..203 CDD:223698 54/199 (27%)
GST_N_Theta 4..79 CDD:239348 21/73 (29%)
GST_C_Theta 93..223 CDD:198292 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.