DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE1 and ATGSTF13

Sequence 1:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana

Alignment Length:213 Identity:64/214 (30%)
Similarity:100/214 (47%) Gaps:25/214 (12%)


  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72
            |||.::|.||..|.|.|...|.::|...|||.|..|....::..||...||.|.|:...:::|.|
plant     5 LYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRA 69

  Fly    73 IAAYLVDKYAK--SDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVP------ 129
            |.||:.:|:..  :|....:|..:.|||......:|.....:|:.|     |:.:..||      
plant    70 ITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAV-----IHQLIVVPLQGESP 129

  Fly   130 -----QEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGP----TVSAVPAAVDIDPATYPK 185
                 :|.|:.:.:.|.:.|..||.:.|||||:.|||||...|    .:..:.|.:..|   .|.
plant   130 NAAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHAGLIND---RPN 191

  Fly   186 VTAWLDRLNKLPYYKEIN 203
            |.||.:.|...|.:.:::
plant   192 VKAWWEDLCSRPAFLKVS 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 27/71 (38%)
GstA 8..197 CDD:223698 63/206 (31%)
GST_C_Delta_Epsilon 94..210 CDD:198287 34/126 (27%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 64/212 (30%)
GST_N_Phi 2..77 CDD:239351 27/72 (38%)
GST_C_Phi 92..208 CDD:198296 34/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.