DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE1 and GSTF11

Sequence 1:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana

Alignment Length:230 Identity:60/231 (26%)
Similarity:101/231 (44%) Gaps:38/231 (16%)


  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDS 70
            :.:||...:...:.|.|.....::::|...|:|...|....:::.:.|...||.::|....:::|
plant     3 VKVYGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFES 67

  Fly    71 HAIAAYLVDKYA-KSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWIN----------- 123
            .|||.|...||| :..:|..|.|..||||:|.:..:.:..||    |:.|..:|           
plant    68 RAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYA----VALPLVMNVVFKPKSGKPC 128

  Fly   124 --GVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKV 186
              .:.|..:.|.|.|   |.:.|..|..:.||.||..||||||..|.:..:     ::..:...:
plant   129 DVALVEELKVKFDKV---LDVYENRLATNRYLGGDEFTLADLSHMPGMRYI-----MNETSLSGL 185

  Fly   187 TAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKL 221
            ....:.||:  ::.||:..||          |.||
plant   186 VTSRENLNR--WWNEISARPA----------WKKL 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 17/73 (23%)
GstA 8..197 CDD:223698 53/203 (26%)
GST_C_Delta_Epsilon 94..210 CDD:198287 34/129 (26%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 60/231 (26%)
GST_N_Phi 2..77 CDD:239351 17/74 (23%)
GST_C_Phi 91..209 CDD:198296 37/143 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.