DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE1 and GSTT2B

Sequence 1:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001074312.1 Gene:GSTT2B HGNCID:33437 Length:244 Species:Homo sapiens

Alignment Length:201 Identity:66/202 (33%)
Similarity:101/202 (50%) Gaps:17/202 (8%)


  Fly     5 GIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWD 69
            |:.|:...:|...|.|.:..|...:..|.:.|:|..|:|.|:|:::.|....:|.|.|....:.:
Human     2 GLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTE 66

  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWIN------GVTEV 128
            |.||..||..||...|..||.||..||.|::.|.:.|..|..:.   ..|.|:.      || :|
Human    67 SSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTF---GIPLWVQVLGPLIGV-QV 127

  Fly   129 PQEKLD----AVHQGLKLLE-TFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDP-ATYPKVT 187
            |:||::    |:.|.|:.|| .|||:.|:|||..:|||||.....:.. |.|:..:. ...|::.
Human   128 PEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQ-PVALGYELFEGRPRLA 191

  Fly   188 AWLDRL 193
            ||..|:
Human   192 AWRGRV 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/73 (29%)
GstA 8..197 CDD:223698 65/199 (33%)
GST_C_Delta_Epsilon 94..210 CDD:198287 37/113 (33%)
GSTT2BNP_001074312.1 GST_N_Theta 3..78 CDD:239348 22/75 (29%)
Glutathione binding 40..41 1/1 (100%)
Glutathione binding 53..54 0/1 (0%)
Glutathione binding 66..67 0/1 (0%)
GST_C_Theta 91..216 CDD:198292 37/113 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92108852
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.