DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE1 and gstt1

Sequence 1:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis

Alignment Length:240 Identity:76/241 (32%)
Similarity:115/241 (48%) Gaps:34/241 (14%)


  Fly     6 IVLYGTDLS-PCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWD 69
            :.||...|| || |:|.:..|..|:.:...:|.|..||||:|||.|.|....||.|.|...|:.:
 Frog     4 LTLYLDLLSQPC-RSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFMAE 67

  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVT------EV 128
            |.|:..|:..|:..:|..||.|:.|.|.|::.|.:..:   .:..|.|:.||:..:|      |.
 Frog    68 STAMLLYMARKFKTADHWYPSDIQKCAKVDEYLAWQHT---NTRPNGSKVFWVKCLTPLILGQEA 129

  Fly   129 PQEKLDAVHQGLKLL-----ETFLGNSPYLAGDSLTLADL-STGPTVSAVPAAVDI-DPATYPKV 186
            |.||:|||.......     |.||||..::|||.:::||| :....:..|...::: |..  ||:
 Frog   130 PAEKVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVADLVAIVEIMQVVAGGINVFDDR--PKL 192

  Fly   187 TAWLDRLNK--------------LPYYKEINEAPAQSYVAFLRSK 217
            .||..|:.:              |...|..:|..|...:.||:||
 Frog   193 AAWKKRVVEALGEELFLEAHEGILNAKKMASEPLAPELMEFLKSK 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 29/74 (39%)
GstA 8..197 CDD:223698 69/217 (32%)
GST_C_Delta_Epsilon 94..210 CDD:198287 38/143 (27%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 30/76 (39%)
GST_C_Theta 92..217 CDD:198292 35/130 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.