DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE1 and Mars

Sequence 1:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006241513.1 Gene:Mars RGDID:1305321 Length:910 Species:Rattus norvegicus

Alignment Length:151 Identity:34/152 (22%)
Similarity:68/152 (45%) Gaps:34/152 (22%)


  Fly    57 VPMLD-DNGTFIWDSHAIAAY--LVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSR 118
            ||:|. |:|.:::.:.||..|  |:..:.:.|           :.||.|.::|:.:...::....
  Rat    48 VPVLQLDSGNYLFSASAICRYFFLLCGWEQDD-----------LTNQWLEWEATELQPVLSAALY 101

  Fly   119 PFWINGVTEVPQEKLDAVHQGLKLLETFLG--NSPYLAGDSLTLADL----STGPTVSAVPAAVD 177
            ...:.|  :..::.|..:.:.|..::..|.  |.|:||||:.:|||:    :..|.:.       
  Rat   102 CLVVQG--KKGEDVLGPLRRVLTHIDHSLSRQNCPFLAGDTESLADIVLWGALYPLLQ------- 157

  Fly   178 IDPATYPK----VTAWLDRLN 194
             |||..|:    :.:|...|:
  Rat   158 -DPAYLPEELGALQSWFQTLS 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 9/25 (36%)
GstA 8..197 CDD:223698 34/152 (22%)
GST_C_Delta_Epsilon 94..210 CDD:198287 24/112 (21%)
MarsXP_006241513.1 Thioredoxin_like 1..68 CDD:294274 7/20 (35%)
GstA <47..189 CDD:223698 34/152 (22%)
GST_C_MetRS_N 77..179 CDD:198340 25/123 (20%)
PRK12268 266..821 CDD:237029
MetRS_core 267..635 CDD:173907
Anticodon_Ia_Met 644..773 CDD:153411
MetRS_RNA 855..899 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.