DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE10 and GstD2

Sequence 1:NP_001286570.1 Gene:GstE10 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:229 Identity:82/230 (36%)
Similarity:119/230 (52%) Gaps:31/230 (13%)


  Fly    16 RAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLVNKYA 80
            |.|::..:||.|:.....|:...|:.|||:.::.|||||:|.|.|....||:|.||..|||.||.
  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77

  Fly    81 QSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLAELKDAYALLEQF 145
            :.|.|.|.||.||||::|||:|:.|.|:.. |.:....||:.......:| |..::.|:..|:.|
  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLYES-FAKYYYPLFRTGKPGSDED-LKRIETAFGFLDTF 140

  Fly   146 LAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYEEDNLRGARLL 210
            |....||||.|||:||.:|::||||..:|  ..|.:||..:|.|.           ||.:     
  Fly   141 LEGQEYVAGDQLTVADIAILSTVSTFEVS--EFDFSKYSNVSRWY-----------DNAK----- 187

  Fly   211 ADKIRSKLPKQFDKLWQ-----KAFEDIKSGAGK 239
                  |:...:|:.|:     ||..|.:..|.|
  Fly   188 ------KVTPGWDENWEGLMAMKALFDARKLAAK 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE10NP_001286570.1 GstA 4..197 CDD:223698 72/181 (40%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/61 (43%)
GST_C_Delta_Epsilon 91..211 CDD:198287 41/120 (34%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 26/61 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 44/142 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92094008
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.