DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BomS1 and BomS3

DIOPT Version :10

Sequence 1:NP_611319.1 Gene:BomS1 / 37100 FlyBaseID:FBgn0034329 Length:45 Species:Drosophila melanogaster
Sequence 2:NP_652368.1 Gene:BomS3 / 50209 FlyBaseID:FBgn0040736 Length:39 Species:Drosophila melanogaster


Alignment Length:41 Identity:31/41 - (75%)
Similarity:34/41 - (82%) Gaps:4/41 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFSVVTVFVLGLLAVANAVPLSPDPGNVIINGDCRVCNV 41
            |||.|:  .|||||||:|||.||  :|||||||||||||||
  Fly     1 MKFLSL--AFVLGLLALANATPL--NPGNVIINGDCRVCNV 37

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BomS1NP_611319.1 DIM 1..40 CDD:400485 28/38 (74%)
BomS3NP_652368.1 DIM 1..36 CDD:400485 28/38 (74%)

Return to query results.
Submit another query.