DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18539 and CheA87a

Sequence 1:NP_611315.3 Gene:CG18539 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_650280.1 Gene:CheA87a FlyBaseID:FBgn0038142 Length:183 Species:Drosophila melanogaster

Alignment Length:177 Identity:40/178 (22%)
Similarity:73/178 (41%) Gaps:23/178 (13%)


  Fly     3 SCC--SLLFLLATLLIDG---CKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTL 62
            |.|  |.|.:||.:::..   .:|.|.:..:  .|...:.|.|.|:...:|.....::...|..|
  Fly     4 SLCPVSYLAVLAIIVLTSNITVQAKRTFRIQ--KLEKVTEDTSYLRSRLRIAESEENELKVSGYL 66

  Fly    63 DWNYDVDKDTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFD 127
            |.|..:|.|..|...|......|.|..|::.:   :....:::..:|||.|.:.:...||     
  Fly    67 DLNQRLDNDWTVVLKVSRSPDSDGDYEKVLTF---EMQLCDFMKSYYKDIFYERIKEYSN----- 123

  Fly   128 GDFVP-----PWPRNVYKLDKCVASGEGLPDIAPEGFYKLEYKMTGQ 169
               .|     |.|:..|.|:....:.:.|..:...|||:::|.:..:
  Fly   124 ---APHPSSCPLPKERYVLEDYPFNVKLLKKLMSPGFYRIKYTLKNE 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 18/82 (22%)
CheA87aNP_650280.1 DM8 91..181 CDD:214778 18/89 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042409
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.