DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18539 and CheA75a

DIOPT Version :9

Sequence 1:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster


Alignment Length:185 Identity:38/185 - (20%)
Similarity:75/185 - (40%) Gaps:14/185 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRS---DYAFSMTLDWNYDV 68
            |:.::...|::..|..:::|.....|..:..|...|.:...:..:||.   :.:|....:.|.| 
  Fly     4 LVIIVLLQLLEKIKCEQSYEVTNERLEPFEGDSQTLVLFDGLKTIGRERALNGSFKFLGEMNND- 67

  Fly    69 DKDTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIK---NVGHCSNMVQFDGDF 130
              |..|..:::...:|| .::|.|...:|:....|....||.. |::   ..|..:|....|.||
  Fly    68 --DFKVSVELYSSPNGD-GEFKRMVMDVPQTSICECFKKFYVQ-FVQPSLKTGETTNFPVVDDDF 128

  Fly   131 VPPWPRNVYKLDKCVASGEGLPDIAPEGFYK--LEYKMTGQVDWGFTLIVKVSPK 183
            .|. |...:.:...:.:.:..|...|.|..|  :.:...|:...|..:.||:..:
  Fly   129 CPV-PEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGKNVGGLIVEVKIEDR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 19/81 (23%)
CheA75aNP_649035.2 DM8 85..180 CDD:214778 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.