DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18539 and CheA46a

DIOPT Version :10

Sequence 1:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster


Alignment Length:66 Identity:15/66 - (22%)
Similarity:32/66 - (48%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDKDTMVEADVHHCSSG 84
            :||.....|.:|.. :..:|:|.:...::  :|| ....:.||:::.|:|.|..:..:|.....|
  Fly    21 RAGLECRIESISKV-FGDNETLFEFNFRV--IGR-QRLLNGTLNFHVDLDDDYEMSNEVLALKDG 81

  Fly    85 D 85
            :
  Fly    82 E 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:461928 0/1 (0%)
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:472716
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.