DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18539 and CG18538

Sequence 1:NP_611315.3 Gene:CG18539 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611314.2 Gene:CG18538 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster

Alignment Length:184 Identity:79/185 (43%)
Similarity:114/185 (62%) Gaps:9/185 (5%)


  Fly     5 CSLLFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLD-WNYDV 68
            |.:..|...||:      |.|:|||:|:.::||||||:|:..||:|:.|..:..:..|. ....:
  Fly     5 CFIAELCMALLL------RKWDYEPISIETHSSDESLIKLDMKIERINRGVFGLTPRLSGTTIRL 63

  Fly    69 DKDTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDFVPP 133
            .|...|||:|...|:||..|||::||:||||..:|:||.:|||..:||..||||:.||:|.|.||
  Fly    64 MKPWYVEANVLRSSTGDVSDYKLLPWAIPKQSLYEHLNTYYKDVSMKNFKHCSNIPQFEGKFQPP 128

  Fly   134 WPRNVYKLDKCVASGEGLPDIAPEGFYKLEYKM--TGQVDWGFTLIVKVSPKVI 185
            .|:..|..:|||..|:|||:|.|.|||.:..|.  .||..|..|.:.|::||::
  Fly   129 LPKQTYFGNKCVIDGDGLPEIVPAGFYLIVIKCYGPGQPTWNTTSVFKITPKLM 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 42/77 (55%)
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 41/75 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042041
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.