DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18539 and CG18537

Sequence 1:NP_611315.3 Gene:CG18539 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611313.1 Gene:CG18537 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster

Alignment Length:181 Identity:93/182 (51%)
Similarity:121/182 (66%) Gaps:2/182 (1%)


  Fly     6 SLLFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDK 70
            |:|.|||..||..|.|.|.|||||:.:.:.|||:||:|:.:.|.||||..:..|..::||||..:
  Fly     7 SVLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDTTE 71

  Fly    71 DTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDFVPPWP 135
            :|||||.|:..:||||.|||::||:||||.|::|||.:|||..:||...|||:.||.|.|.||||
  Fly    72 ETMVEAVVYRSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWP 136

  Fly   136 RNVYKLDKCVASGEGLPDIAPEGFYKLEYKMTG--QVDWGFTLIVKVSPKV 184
            :..|..||||...||.|||.|.||||:.:..||  |..|.|..|.|:..|:
  Fly   137 KRTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKM 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 46/77 (60%)
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 52/88 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042065
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.