DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18539 and CG18536

Sequence 1:NP_611315.3 Gene:CG18539 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611312.1 Gene:CG18536 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster

Alignment Length:182 Identity:95/183 (52%)
Similarity:127/183 (69%) Gaps:10/183 (5%)


  Fly     5 CSLLFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVD 69
            |.|..|.|        |.|.|:|||:.||:.|||||.||...||:|||||||..|..|:|.||.:
  Fly    17 CILFHLTA--------ASRKWDYEPILLTATSSDESKLKFEAKIERLGRSDYGLSAILEWKYDTN 73

  Fly    70 KDTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDFVPPW 134
            ::|||||..:..:||||.|||::||:||||||::|:|.:|||...||:|:|||:.:::..|.|||
  Fly    74 EETMVEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYEDKFQPPW 138

  Fly   135 PRNVYKLDKCVASGEGLPDIAPEGFYKLEYKM--TGQVDWGFTLIVKVSPKV 184
            |:|.||||||...|:|||:|||.||||:.:..  .||..||||.:.|::.|:
  Fly   139 PKNTYKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLTNKI 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 47/77 (61%)
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 47/77 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042022
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.