DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18539 and CG14502

Sequence 1:NP_611315.3 Gene:CG18539 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001163192.1 Gene:CG14502 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster

Alignment Length:176 Identity:87/177 (49%)
Similarity:133/177 (75%) Gaps:0/177 (0%)


  Fly    10 LLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDKDTMV 74
            :|..|::|.|...|.|:|||||:.:|::||:.|||..|::|:||.:||.|..:::.|..:.:|||
  Fly    13 VLILLIVDQCNGKRKWDYEPLSIETYTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPEDNTMV 77

  Fly    75 EADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDFVPPWPRNVY 139
            ||..:..:||||:|||:||:||||||:.|::|..||:..:.|:|.|||:::|||.|.||||::.|
  Fly    78 EAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEPPWPQDTY 142

  Fly   140 KLDKCVASGEGLPDIAPEGFYKLEYKMTGQVDWGFTLIVKVSPKVI 185
            .|:||||:.:|.||:.|||:||:.:.:|..|||||.||||::.|::
  Fly   143 VLEKCVANSDGFPDMVPEGYYKVNFTLTNPVDWGFILIVKITTKLV 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 44/77 (57%)
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 44/77 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042134
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.