DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18537 and CG14502

Sequence 1:NP_611313.1 Gene:CG18537 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001163192.1 Gene:CG14502 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster

Alignment Length:180 Identity:84/181 (46%)
Similarity:130/181 (72%) Gaps:5/181 (3%)


  Fly     8 VLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDTTEE 72
            |||||   ::.:|...|||:|||:.|.|.::|::.:|:.:.:.|:|||::.:|..:|:.|...:.
  Fly    13 VLILL---IVDQCNGKRKWDYEPLSIETYTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPEDN 74

  Fly    73 TMVEAVVYRSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWPK 137
            |||||:.|||.||||:|||::|::||||.:.:::||:||:|::.|...|||:.:|.|||:||||:
  Fly    75 TMVEAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEPPWPQ 139

  Fly   138 RTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKM 187
            .||:.:|||..::||||:||.|:||:.|..|.|  ..|.||.|.||..|:
  Fly   140 DTYVLEKCVANSDGFPDMVPEGYYKVNFTLTNP--VDWGFILIVKITTKL 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 49/88 (56%)
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 41/77 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042120
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.