DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18536 and CheA46a

DIOPT Version :10

Sequence 1:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster


Alignment Length:175 Identity:37/175 - (21%)
Similarity:56/175 - (32%) Gaps:62/175 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ESKLKFEAKIERLGR---------------SDYGLS-AILEWKYDTNEETMVEAQAYRSNSGDES 91
            :::..||.....:||               .||.:| .:|..|....|.|.|.|:          
  Fly    37 DNETLFEFNFRVIGRQRLLNGTLNFHVDLDDDYEMSNEVLALKDGEWESTSVSAR---------- 91

  Fly    92 DYKLLPW-AIPKQPFYD-YINTYYKDVISKNLGYCSNLPKYEDKFQPPWPKNTYKLDKCKIGGDG 154
             :|...: |:    .|| |....:||         ||:||..:..  |..|..|.....::..|.
  Fly    92 -FKTCKYMAV----IYDKYFAVSFKD---------SNIPKGTEAC--PIKKGEYYARNVEVIADN 140

  Fly   155 LPEIAPPGFYK---------IVFTKFGPGQPTWGFTAVFKLTNKI 190
            ....|..|..:         :|:         .||..|..|:.||
  Fly   141 WAHYAKLGLVRSNMLVRKNNVVY---------GGFDIVLVLSQKI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18536NP_611312.1 DUF1091 78..166 CDD:461928 19/98 (19%)
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:472716 19/91 (21%)

Return to query results.
Submit another query.