DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5726 and Ctif

DIOPT Version :8

Sequence 1:NP_611304.1 Gene:CG5726 / 37082 FlyBaseID:FBgn0034313 Length:766 Species:Drosophila melanogaster
Sequence 2:NP_001102361.1 Gene:Ctif / 364900 RGDID:1311887 Length:336 Species:Rattus norvegicus

Alignment Length:232 Identity:56/233 (24%)
Similarity:96/233 (41%) Gaps:37/233 (16%)


  Fly    83 IIALMRNLDLQDDGIVLNSKIKTIETDFCNIVRDESMLCESMEYLNDKALSDGDTALKFALLFSS 147
            |:..|||     :...:::|:.:...:..|....|.||.|.:..:..||:||...|...|.|...
  Rat   126 ILNSMRN-----NSSDVDAKLTSFMEEAQNSTNSEEMLGEIVRTIYQKAVSDRSFAFTAAKLCDK 185

  Fly   148 RNFDALAMKE-TKVRSAMLKILETNFLNADAYRLHDKNRLYNSITLLGEYYHRVRLADNTPITIL 211
            .   ||.|.| ||.||.:|.:|:.:|...:..:..|..|....||.|.|.:..:|.:...|..:|
  Rat   186 M---ALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRSSTGEPFRVL 247

  Fly   212 -------GESLLDLLTRELNDTSVVLGTRIARLVLSQITLNGEIMRKRHKVEIDLLLFHVRRHLI 269
                   .|..:...:.||..|        .||:..|:.   |:|.:         |....|..:
  Rat   248 LLQSQDVKEDAVLCCSMELQST--------GRLLEEQLP---EMMTE---------LLASARDKM 292

  Fly   270 MQPALTAKVKAMLLMVLDLFYSHFKHIGHDLETMYTN 306
            :.|:.:...:::||.|::|..:.:..:...: |.|.|
  Rat   293 LCPSESMLTRSLLLEVIELHANSWNPLTPPI-TQYYN 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5726NP_611304.1 None
CtifNP_001102361.1 MIF4G 125..315 CDD:280935 53/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3942
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.