DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10915 and Cttnbp2

DIOPT Version :8

Sequence 1:NP_001286565.1 Gene:CG10915 / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_525024.1 Gene:Cttnbp2 / 30785 MGIID:1353467 Length:1648 Species:Mus musculus

Alignment Length:687 Identity:165/688 (24%)
Similarity:250/688 (36%) Gaps:247/688 (36%)


  Fly    82 SELVKMLYYLEGELQARDVCIAALRNERVKQLIAQLRTKRLQPNDPYAAIFRDKIALNGNLISRE 146
            |||..:|..:||||:|||:.|.|||..| |::..|.|..|...|||:.|:.||..|..|:     
Mouse    39 SELRMLLSVMEGELEARDLVIEALRARR-KEVFIQERYGRFNLNDPFLALQRDYEAGPGD----- 97

  Fly   147 SSTQAAQAEMEVRQIIEQQMEQQYQMVSKQRATHVRMVNILTESLENNQRMLQELEEEKRKHENT 211
                                        |::......::||...:.:.::|          .|..
Mouse    98 ----------------------------KEKPVCTNPLSILEAVMAHCRKM----------QERM 124

  Fly   212 TAQGDDITYGLELERNKLKQDLEEERAQVAKMEKDLKKLQETLEYERNRQKQIVLLLIAERKKIL 276
            :||       |....::.|: ||.|:.|:..:|::.|||...||.||.:.|.:||:|:.|.|::.
Mouse   125 SAQ-------LVAAESRQKK-LEMEKLQLQALEQEHKKLAAHLEEERGKNKHVVLMLVKECKQLS 181

  Fly   277 MKYIEEGKRSEDLAQILAEEKQRSDTIAEGLEEESKKSLRMEEELEKQTHAMEQERKVLFAKLAK 341
            .|.:||.::.|::...|.|||:::..:.|.|..|.::|..||.:||||....:.||:.|.|||::
Mouse   182 GKVVEEAQKLEEVMAQLEEEKKKTSELEEQLSAEKQRSSGMEAQLEKQLSEFDTEREQLRAKLSR 246

  Fly   342 EELRVKELEQELNALRSEHEALKKQQQLGGSGSSVAAAKARQFSDD-----------------AC 389
            ||....:|::|::.::...|.:||     ||......:..|:..|.                 ||
Mouse   247 EEAHTTDLKEEIDKMKKMMEQMKK-----GSDGKPGLSLPRKTKDKRLASISVATEGPVTRSVAC 306

  Fly   390 AT------------------------PPMV------NI---AKIVQ----------------PTA 405
            .|                        .|:|      |:   |.:::                |||
Mouse   307 QTDVVTESTDPVKKLPLTVPIKPSTGSPLVPTNTKGNVGPSALLIRPGIDRQSSHSDLGPSPPTA 371

  Fly   406 TVSS---MPVSGPQTGIARSIAPGQNIRSAGIATAPTGTATAAI-APLTAVLNHTTTITTTT--- 463
            ..||   :..:||.||.|..:       |....:.|:.||.||. .|.||..||:...|..:   
Mouse   372 LPSSANRIEENGPSTGNAPDL-------SNSTPSTPSSTAPAAAQTPGTAPQNHSQAPTVHSLHS 429

  Fly   464 -------------------------------NNTT------------------------------ 467
                                           |||.                              
Mouse   430 PCANTHPGLNPRIQAARFRFQGNANDPDQNGNNTQSPPSRDVSPTSRDNLVAKQLARNTVTQALS 494

  Fly   468 --TSSNSNSSGSIGV-----AATAAAVA-ASVETAATVTVPMVAPPSPSPAKMQPTATIQRAPGG 524
              ||..:.:|..:||     |.|...|. ..::|.....|....||...|.|          || 
Mouse   495 RFTSPQAGASSRLGVSPGGDAGTCPPVGRTGLKTPGAARVDRGNPPPIPPKK----------PG- 548

  Fly   525 KYAALAAAAALDQTTTPHPHP-------------VPIAVPPVTVPPAGARGAPPPIP--TKPIVP 574
                      |.||.:| |||             ..:|.||.|:|..........:|  :.|.:|
Mouse   549 ----------LSQTPSP-PHPQLRASNAGAKVDNKIVASPPSTLPQGTKVVNEENVPKSSSPQLP 602

  Fly   575 PKREPSLSRLGSITGS--SAIAAATAATTAAGTAKQN 609
            ||  ||:....:..|.  ||:|.:......|||...|
Mouse   603 PK--PSIDLTVAPAGCPVSALATSQVGAWPAGTPGLN 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10915NP_001286565.1 CortBP2 78..274 CDD:286770 55/192 (29%)
Angiomotin_C 189..381 CDD:289044 57/192 (30%)
Cttnbp2NP_525024.1 CortBP2 36..179 CDD:286770 55/192 (29%)
HrpB7 108..258 CDD:286561 54/168 (32%)
DUF4472 133..239 CDD:291409 39/107 (36%)
Ank_2 674..764 CDD:289560
ANK 1 699..729
ANK repeat 702..731 CDD:293786
ANK 728..853 CDD:238125
ANK repeat 733..764 CDD:293786
ANK 2 733..762
Ank_2 738..829 CDD:289560
ANK repeat 766..797 CDD:293786
ANK 3 766..795
ANK repeat 799..830 CDD:293786
ANK 4 799..828
Ank_2 804..925 CDD:289560
ANK 828..>953 CDD:238125
ANK 5 832..861
ANK repeat 901..933 CDD:293786
ANK 6 901..931
PRK11331 <1071..1357 CDD:183088
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616218
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.