DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and KMT2B

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_055542.1 Gene:KMT2B HGNCID:15840 Length:2715 Species:Homo sapiens

Alignment Length:1743 Identity:294/1744 (17%)
Similarity:477/1744 (27%) Gaps:756/1744 (43%)


  Fly    85 HQMNPLLAPPYSGTLPFNSMDLSLQSARSAAQPLAKQPPNQQPHQ-TQQQQQSL------IHAPN 142
            |:..||..|..:...|              ..|  |.|..::..: |::..|:|      ..||.
Human   156 HKTTPLPPPRLADVAP--------------TPP--KTPARKRGEEGTERMVQALTELLRRAQAPQ 204

  Fly   143 YPSIQNLTTNATPTSTQLQQQ-----------QQQEHLAAMAAAHVSLLQSSRQNQGAPSGNLSN 196
            .|     .:.|...||..:.:           ::::....:|.|.|::.:........|..:.:.
Human   205 AP-----RSRACEPSTPRRSRGRPPGRPAGPCRRKQQAVVVAEAAVTIPKPEPPPPVVPVKHQTG 264

  Fly   197 GGDCESLLPPPPPTSVSGNTNHTGSNSSSNSGSNNHIASPHYMQSRDENFKLTQLKRSFEPDLSG 261
            ...|:....|.|.|...|..:..|.......|....:.......||.:..|:.||....|   ||
Human   265 SWKCKEGPGPGPGTPRRGGQSSRGGRGGRGRGRGGGLPFVIKFVSRAKKVKMGQLSLGLE---SG 326

  Fly   262 KN-----------PQKEKDFGYPSA----SSASKLPTHNVQQQHANKKPS--------------- 296
            :.           ||:....|...:    ....||.....:::...:|..               
Human   327 QGQGQHEESWQDVPQRRVGSGQGGSPCWKKQEQKLDDEEEEKKEEEEKDKEGEEKEERAVAEEMM 391

  Fly   297 PLRNYHQQQQPPYNLTPKYNGPQTPPTPQSPLAANPHQMLSPTMDYNQLHLHHQLNSSSGGSYQH 361
            |.....:.:.||..|||.   ..:||.|..|.:.:|...|.|                       
Human   392 PAAEKEEAKLPPPPLTPP---APSPPPPLPPPSTSPPPPLCP----------------------- 430

  Fly   362 MQQDQTQSQSHPQHLHYHNQHATSQTAPPPLLPPLLTSGQFHAQPQDASQQQ--------TASSS 418
                                     ..|||:.||.|.|    ..|..|.::|        .|:.|
Human   431 -------------------------PPPPPVSPPPLPS----PPPPPAQEEQEESPPPVVPATCS 466

  Fly   419 QHQTHHSRTAQLTNLDQAVKHKPESEEQPVITDLSYRNSETDKTAANPVPE-----APESPYLTT 478
            :.:.....|.......:|.:..||....|         :.|..||....||     ||:|.....
Human   467 RKRGRPPLTPSQRAEREAARAGPEGTSPP---------TPTPSTATGGPPEDSPTVAPKSTTFLK 522

  Fly   479 SNEESLESNSNSSNSR--------------KRRKRKASMVMR--VTPNENAPEGENSKPQHPQQA 527
            :..:.:....::.:||              |..|.:.|.|:|  :|          :.|..||:.
Human   523 NIRQFIMPVVSARSSRVIKTPRRFMDEDPPKPPKVEVSPVLRPPIT----------TSPPVPQEP 577

  Fly   528 ANLNNSCSPKKSPKNGGGEFQPFSTQKQSQTENEKTTQENGRGGSPAPAENNSNSNSSTLYNDNE 592
            |.:.   ||.::|       .|.||                    |.|                 
Human   578 APVP---SPPRAP-------TPPST--------------------PVP----------------- 595

  Fly   593 NPKTKKQRQALLQRNLTEQHRMQQDDEPPKNHTSPAMPPPSPQSNSSSSSSSSSSANTHSSQSSH 657
               ..::|:::|:........:.::..||     |..|||.|..:...:.::||           
Human   596 ---LPEKRRSILREPTFRWTSLTRELPPP-----PPAPPPPPAPSPPPAPATSS----------- 641

  Fly   658 AVNNIPKPEINNKATTDTPASPALVEQGDIDAKPAVSVHECDEEEEPAVNKVSPAHPDP------ 716
                  :..:..:|...||:...|.....:...|.:...|..|.|.|..:. |||.|:|      
Human   642 ------RRPLLLRAPQFTPSEAHLKIYESVLTPPPLGAPEAPEPEPPPADD-SPAEPEPRAVGRT 699

  Fly   717 --------------PTTAAVA---AP-----PATE------------------------------ 729
                          |..|.|:   ||     |.|:                              
Human   700 NHLSLPRFAPVVTTPVKAEVSPHGAPALSNGPQTQAQLLQPLQALQTQLLPQALPPPQPQLQPPP 764

  Fly   730 SPKKSSP-----AANSESCPFGEVEDKL--------EQMFAGIEEETERIS-----SPEKPAEES 776
            ||::..|     .|...|.|...||:|:        .|:|...:::.::::     ||....||.
Human   765 SPQQMPPLEKARIAGVGSLPLSGVEEKMFSLLKRAKVQLFKIDQQQQQKVAASMPLSPGGQMEEV 829

  Fly   777 AAMVAHNLTAQLA-LDPSKTLDTPAENQTSVLAVLAPNQTPT--------PEIRPVATKAAM--- 829
            |..|     .|:: ..|.::.|...|         |..:.|:        |.|:.|...||:   
Human   830 AGAV-----KQISDRGPVRSEDESVE---------AKRERPSGPESPVQGPRIKHVCRHAAVALG 880

  Fly   830 --KSTMPSPVHSPIPQSRSTSTPL-----VAGDDSKS---NTPVPAK------------------ 866
              ::.:|..|      .|.::.||     :|.:|:.|   ...||::                  
Human   881 QARAMVPEDV------PRLSALPLRDRQDLATEDTSSASETESVPSRSRRGKVEAAGPGGESEPT 939

  Fly   867 ------APAPRRPPP-------RRLSMGMDASLLRFM--------IDDPPAKKPGRKKK--VTKE 908
                  |..|||..|       |....|.....||..        :|.|....|..||:  |.::
Human   940 GSGGTLAHTPRRSLPSHHGKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRK 1004

  Fly   909 PDFEDDDKPSTSAAAAAALAARQLS-EAASATKSKPAAGAKKKNAGVKGKKGS--AGKGNAKNAK 970
            .|..:..|....|.....:....|. ::..:.::.|.....::.||..|.:..  |..|..:...
Human  1005 CDKIEARKMERLAKKGRTIVKTLLPWDSDESPEASPGPPGPRRGAGAGGPREEVVAHPGPEEQDS 1069

  Fly   971 QNGKKSAR-----KPAFTTDEDS--------------------TPAPTNGGGSVPELRFKSPFIL 1010
            ...:||||     :|::...|||                    .|.|.....|.|......|.:.
Human  1070 LLQRKSARRCVKQRPSYDIFEDSDDSEPGGPPAPRRRTPRENELPLPEPEEQSRPRKPTLQPVLQ 1134

  Fly  1011 IK----------------------------PDG----SVSIKNTHSAEDV-----NEKQTKVKKA 1038
            :|                            |||    .|..|.....|:|     ....|.|...
Human  1135 LKARRRLDKDALAPGPFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSVPGG 1199

  Fly  1039 P------------HE------------------------------------------RKNLRG-- 1047
            |            ||                                          ||. ||  
Human  1200 PPMVCLLCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKG-RGSK 1263

  Fly  1048 -----------MHSSTLSNRYDADTTDST--WICVFCKR-----------------GPHKL---- 1078
                       .|.:.|...|....|...  |||..|.|                 |.:.|    
Human  1264 HLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGATPGKNWDVEWSGDYSLCPRC 1328

  Fly  1079 -----------------------------------------GLGD-------------------- 1082
                                                     ||.|                    
Human  1329 TQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYTCGPC 1393

  Fly  1083 -------------------------------LFGPYLVTSDC----------------------D 1094
                                           :.||.|:.:.|                      |
Human  1394 AGAAQPRWREALSGALQGGLRQVLQGLLSSKVVGPLLLCTQCGPDGKQLHPGPCGLQAVSQRFED 1458

  Fly  1095 EYRAAVQTPGAQDIDGMFVN--------KRRREDMVKG----------------------QERNL 1129
            .:..:|.: ..:|:.|:.:.        .||....:||                      :...|
Human  1459 GHYKSVHS-FMEDMVGILMRHSEEGETPDRRAGGQMKGLLLKLLESAFGWFDAHDPKYWRRSTRL 1522

  Fly  1130 PAVPATLANIMQAPKI----SMHKRKRKQTHDS-----------------SISYSDDPNESRSQC 1173
            |  ...|.|.:..|.:    :..:::..:|.:|                 :.|:.:||.:     
Human  1523 P--NGVLPNAVLPPSLDHVYAQWRQQEPETPESGQPPGDPSAAFQGKDPAAFSHLEDPRQ----- 1580

  Fly  1174 SSVDLLDCSTESKFVET-FRGMGKTSENGFEVWLHEDCAVWS------NDIHLIGAHVNGLDAAV 1231
                   |:...|:.:. .:..|:....|...|.|.:||:||      ||..|...|     |||
Human  1581 -------CALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVH-----AAV 1633

  Fly  1232 WDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANWSLSEEDRKVYCHLH 1284
            ....:.:|.||.:.||::.|....|.:..|..|.| |::.:.::|:||:|..|
Human  1634 ARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCAR-ASYCIFQDDKKVFCQKH 1685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 62/409 (15%)
KMT2BNP_055542.1 zf-CXXC 958..1005 CDD:251032 10/47 (21%)
PHD1_KMT2B 1203..1249 CDD:277064 2/46 (4%)
PHD2_KMT2B 1251..1300 CDD:277066 11/50 (22%)
PHD3_KMT2B 1337..1393 CDD:277068 3/56 (5%)
Bromo_ALL-1 1374..1516 CDD:99925 12/143 (8%)
ePHD_KMT2B 1581..1685 CDD:277164 32/110 (29%)
FYRN 1734..1780 CDD:283589
FYRC 2413..2497 CDD:197781
SET <2559..2715 CDD:225491
SET 2577..2697 CDD:214614
S-adenosyl-L-methionine binding. {ECO:0000250} 2652..2653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.