DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and phf6

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001107695.1 Gene:phf6 XenbaseID:XB-GENE-999439 Length:363 Species:Xenopus tropicalis

Alignment Length:261 Identity:51/262 (19%)
Similarity:91/262 (35%) Gaps:67/262 (26%)


  Fly  1088 LVTSDCDEYRAAVQTPGAQDIDGMFVNK--------------RRREDMVKGQERNLPAVPATLAN 1138
            :.|..|.:::..||. ...:::|.|..:              :.|....:||...     :.|::
 Frog   123 MYTIFCRKHKEQVQN-SDDELEGSFTRRGLAPQRGRGRGSRGKSRTSNSRGQSEE-----SRLSS 181

  Fly  1139 IMQAPKISMHKRKRKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSE-NGF 1202
            :....:......:.:..|.||      |:::|.:|......|...|::        ||... |..
 Frog   182 LHCTEETESSSSRDRSPHRSS------PSDTRPKCGFCHAGDEENETR--------GKLHVFNAK 232

  Fly  1203 EVWLHEDCAVWSN----------------DIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICC 1251
            :...|..|.::|:                ||..:...:.       ...|.:|.||...||:|.|
 Frog   233 KAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVIQEMK-------RGKRMKCTLCGLLGATIGC 290

  Fly  1252 FQRCCKAAAHVPCG--RSANW--SLSEEDRKVYCHLH-----RHEPGVVEPIKTESIAPVEVSVA 1307
            ..:.|....|..||  ..|.:  ::|....|:||..|     |.|......|:::..|.|..|.:
 Frog   291 EIKACVKTYHYHCGVEDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEEREIRSKGNATVGHSQS 355

  Fly  1308 T 1308
            |
 Frog   356 T 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 43/231 (19%)
phf6NP_001107695.1 ePHD1_PHF6 17..131 CDD:277180 2/8 (25%)
ePHD2_PHF6 210..327 CDD:277181 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.