DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and Kmt2b

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001277502.1 Gene:Kmt2b MGIID:109565 Length:2722 Species:Mus musculus

Alignment Length:1521 Identity:270/1522 (18%)
Similarity:443/1522 (29%) Gaps:554/1522 (36%)


  Fly    64 PPPPDAIYNFMSANHKNLDHHHQMNPLLAPPYSGTLPFNSMDLSLQSARSAAQPLAKQPP-NQQP 127
            ||||                       |.||.:...|         .|.....|::..|| :..|
Mouse   425 PPPP-----------------------LPPPSTSPPP---------PASPLPPPVSPPPPLSPPP 457

  Fly   128 HQTQQQQQSLIHAPNYPSIQNLTTNATPTSTQLQQQQQQEHLAAMAAAHVSLLQSSRQNQGAPSG 192
            :...::|:.  ..|..|:..:......|    |...|:.|..||               :..|.|
Mouse   458 YPAPEKQEE--SPPLVPATCSRKRGRPP----LTPSQRAEREAA---------------RSGPEG 501

  Fly   193 NLSNGGDCESLLPPPPPTSVSGN---TNHTGSNSSSNSGSNNHIASPHYMQSRDENFKLTQLKRS 254
            .||         |.|.|::.:|:   .:.|....|:....|........:.:|..  ::.:..|.
Mouse   502 TLS---------PTPNPSTTTGSPLEDSPTVVPKSTTFLKNIRQFIMPVVSARSS--RVIKTPRR 555

  Fly   255 FEPDLSGKNPQKEKDFGYPSASSASKLPTHNVQQQHANKKPSP--------------LR------ 299
            |..:...|.|:.|.....|..:::...|...|......:.|:|              ||      
Mouse   556 FMDEDPPKPPKVEASIVRPPVATSPPAPQEPVPVSSPPRVPTPPSTPVPLPEKRRSILREPTFRW 620

  Fly   300 -NYHQQQQPPYNLTPKYNGPQTPPTPQSPLAANPHQMLSPTMDYNQLHL---HHQLNSSSGGSYQ 360
             :..::..||....|.  .|..||.|.:| :..|..:.:|....::.||   ...|.....|:.:
Mouse   621 TSLTRELPPPPPAPPP--APSPPPAPATP-SRRPLLLRAPQFTPSEAHLKIYESVLTPPPLGALE 682

  Fly   361 HMQ-----QDQTQSQSHPQHLHYHNQHATSQTAP----------PPLLPPLLTSGQF-------- 402
            ..:     .|.:.::..|:.:...|..:..:..|          ||...|.|:.||.        
Mouse   683 TPEPELPPADDSPAEPEPRAVGRTNHLSLPRFVPVVTSPVKVEVPPHGAPALSEGQQLQLQQPPQ 747

  Fly   403 --------HAQPQDASQQQTASSSQH--QTHHSRTAQLTNLD-QAVKHK---------------P 441
                    .|.|....|.|...|.||  ....:|.|.|.:|. ..|:.|               .
Mouse   748 ALQTQLLPQALPPQQPQAQPPPSPQHTPPLEKARVASLGSLPLSGVEEKMFSLLKRAKVQLFKID 812

  Fly   442 ESEEQPVITDLSYRNSETDKTAANPVPEAPESPYLTTSNEESLESNSNSSNSRKRRKRKASMVMR 506
            :.::|.|...:....:...:.|...|.:.|:.. ...|.:||:|:         :|.|.      
Mouse   813 QQQQQKVAASMPLSPAVQTEEAVGTVKQTPDRG-CVRSEDESMEA---------KRDRA------ 861

  Fly   507 VTPNENAPEGENSKPQHPQQAANLNNSCS-----------------PKKS--PKNGGGEFQPFST 552
                        |.|:.|.|...:.:.|.                 |:.|  |.....:.....|
Mouse   862 ------------SGPESPLQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLATEDT 914

  Fly   553 QKQSQTEN------EKTTQENGRGGSPAPAENNSN------------------------------ 581
            ...|:||:      .:..:..|.||...|..:...                              
Mouse   915 SSASETESVPSRSQREKVESAGPGGDSEPTGSTGALAHTPRRSLPSHHGKKMRMARCGHCRGCLR 979

  Fly   582 -SNSSTLYNDNENPK-----TKKQRQALLQRNLTEQHRMQQ----------------DDEPPKNH 624
             .:..:..|..:.||     ||||.....:.:..|..:|::                .||.|:  
Mouse   980 VQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKGRTIVKTLLPWDSDESPE-- 1042

  Fly   625 TSPAMPPPSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKATTDTPASPALVEQGDIDA 689
            .||.  ||.|:..:.:..|...            |...|.||..:.......::...|:|     
Mouse  1043 ASPG--PPGPRRGAGAGGSREE------------VGATPGPEEQDSLLLQRKSARRCVKQ----- 1088

  Fly   690 KPAVSVHECDEEEEPAVNKVSPAHPDPPTTAAVAAPPATESPKKSSPAANSESCPFGEVEDKLEQ 754
            :|:..|.|..::.||                  ..|||   |::.:|.           |.:|..
Mouse  1089 RPSYDVFEDSDDSEP------------------GGPPA---PRRRTPR-----------EHELPV 1121

  Fly   755 MFAGIEEETERISSPEKPAEESAAMVAHNLTAQLALDPSKTLDTPAENQTSVLAVLAPNQTPTPE 819
            :      |.|..|.|.||          .|...|.|...:.||..|         |||.      
Mouse  1122 L------EPEEQSRPRKP----------TLQPVLQLKARRRLDKDA---------LAPG------ 1155

  Fly   820 IRPVATKA---AMKSTMPSPVHSPIPQSRS----TSTPLVAGDDSKSNTPVPAKAPAPRRPPPRR 877
              |.|:..   ..|...|..||......:.    .:..|:.|        :......|..||...
Mouse  1156 --PFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGG--------LSVLTSVPGGPPMVC 1210

  Fly   878 L---SMGMDASLLRFMIDDP-------PAKKP-------------------GRKKKVTKEPDFED 913
            |   |.|:...:...:..||       .|::|                   |||.:.:|.     
Mouse  1211 LLCASKGLHELVFCQVCCDPFHPFCLEEAERPSPQHRDTWCCRRCKFCHVCGRKGRGSKH----- 1270

  Fly   914 DDKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKK-----NAGVKGKKGSAGKGNAKNAKQNG 973
                     .......|.....|....|.|....:::     :|.|:.|...|..|...:.:.:|
Mouse  1271 ---------LLECERCRHAYHPACLGPSYPTRATRRRRHWICSACVRCKSCGATPGKNWDVEWSG 1326

  Fly   974 KKSARKPAFTTDEDSTPAPTNGGGSVPELRFKSPFILIKPDGSVSIKNTHSAEDVNEKQTKVKKA 1038
                       |....|..|       ||..|..:..|       ....:...|...|..:..:.
Mouse  1327 -----------DYSLCPRCT-------ELYEKGNYCPI-------CTRCYEDNDYESKMMQCAQC 1366

  Fly  1039 PH------------ERKNLRGMHSSTLSNRYD----ADTTDSTWICVFCKRGPHKLGLGDLF--- 1084
            .|            :.:.|.|:..|.|   |.    |..|...|....  .|..:.||..:.   
Mouse  1367 DHWVHAKCEGLSDEDYEILSGLPDSVL---YTCGPCAGATQPRWREAL--SGALQGGLRQVLQGL 1426

  Fly  1085 ------GPYLVTSDCDEYRAAVQTPGAQDI--------DGMFVN--------------------- 1114
                  ||.|:.:.|.:....:. ||..|:        :|::.:                     
Mouse  1427 LSSKVAGPLLLCTQCGQDGKQLH-PGPCDLQAVGKRFEEGLYKSVHSFMEDVVAILMRHSEEGET 1490

  Fly  1115 -KRRREDMVKG----------------------QERNLPAVPATLANIMQAPKI----SMHKRKR 1152
             :||....:||                      :...||  ...|.|.:..|.:    :..:::.
Mouse  1491 PERRAGSQMKGLLLKLLESAFCWFDAHDPKYWRRSTRLP--NGVLPNAVLPPSLDHVYAQWRQQE 1553

  Fly  1153 KQTHDS-----------------SISYSDDPNESRSQCSSVDLLDCSTESKFVET-FRGMGKTSE 1199
            .:|.:|                 :.|:.|||.:            |:...|:.:. .:..|:...
Mouse  1554 SETPESGQPPGDPSAAFQSKDPAAFSHLDDPRQ------------CALCLKYGDADSKEAGRLLY 1606

  Fly  1200 NGFEVWLHEDCAVWS------NDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKA 1258
            .|...|.|.:||:||      ||..|...|     |||....:.:|.||.:.||::.|....|.:
Mouse  1607 IGQNEWTHVNCAIWSAEVFEENDGSLKNVH-----AAVARGRQMRCELCLKPGATVGCCLSSCLS 1666

  Fly  1259 AAHVPCGRSANWSLSEEDRKVYCHLH 1284
            ..|..|.| |::.:.::|:||:|..|
Mouse  1667 NFHFMCAR-ASYCIFQDDKKVFCQKH 1691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 58/305 (19%)
Kmt2bNP_001277502.1 zf-CXXC 963..1010 CDD:251032 7/47 (15%)
PHD1_KMT2B 1209..1255 CDD:277064 7/46 (15%)
PHD2_KMT2B 1257..1306 CDD:277066 9/63 (14%)
PHD3_KMT2B 1343..1399 CDD:277068 9/66 (14%)
Bromo_ALL-1 1380..1522 CDD:99925 23/148 (16%)
ePHD_KMT2B 1587..1691 CDD:277164 32/110 (29%)
FYRN 1740..1786 CDD:283589
FYRC 2420..2504 CDD:197781
SET <2566..2722 CDD:225491
SET 2584..2704 CDD:214614
S-adenosyl-L-methionine binding. {ECO:0000250} 2659..2660
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.