DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and LOC733724

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_002935796.2 Gene:LOC733724 XenbaseID:XB-GENE-5933368 Length:804 Species:Xenopus tropicalis

Alignment Length:705 Identity:136/706 (19%)
Similarity:243/706 (34%) Gaps:215/706 (30%)


  Fly   217 NHTGSNSSSNSGSNNH--IASPHYMQSRDENFKLTQLKRSFEPDLSGKNPQKEKDFGYPSASSAS 279
            :.|.|:||::|.:::.  :.:|...:.|.        |:..|    ||.|:|:         :.:
 Frog   142 SETSSDSSTSSSTDDSDTLGTPRARKKRK--------KKGNE----GKTPRKK---------TKA 185

  Fly   280 KLPTHNVQQQ-----------------HANKKPSPLRNYHQQQQPPYNLTPKYNGPQTPPTPQSP 327
            |...||..:|                 |::......|...::|:.|.:.||:..           
 Frog   186 KGADHNGDKQGDAHYSSDSTDPGPSSRHSDASNKEERQKQEKQRDPEDTTPREK----------- 239

  Fly   328 LAANPHQML------SPTMDYNQLHL-----HHQLNSSSGGSYQHMQQDQTQSQS---HPQHLHY 378
              .|..:.|      :...|.:::.|     .|..:.....|...:.:....||.   ||..|..
 Frog   240 --TNARKSLFAMVTENENQDADEVPLPVQGTSHDTSCDRSSSEGELSESLLSSQPVLLHPVSLRD 302

  Fly   379 HNQHATSQTAPPPLLPPLLTSGQFHAQPQDASQQQTASSSQHQTHH----SRTAQLTNLDQAVKH 439
            ..:....:.|               :..:.:||:..:|..|.....    |..:|.::|:.|.:|
 Frog   303 LKKKQRKKRA---------------SNVEASSQEDISSQDQRMLFQLWSLSSLSQDSSLNIASQH 352

  Fly   440 K---------PESEEQPVITDLSYRNSETD------KTAANPVPEAPES----PYLTTSNEESLE 485
            .         .|....||.||    .:.||      |...|.:.|.||.    ..::||..|:..
 Frog   353 NEGLNDGDTAAEQNAIPVSTD----GTSTDDSIKKKKPVDNNLAEGPECSARVENISTSQSENCY 413

  Fly   486 SNSNSSNSRKRRKRKASMVMRVTPNENAPEGENSKPQHPQQAA----NLNNSCSPKKSPKNGGGE 546
            :.:|..::.....:..|:|.    :.|:|:.::.:...|..::    ..|..|.       ||..
 Frog   414 NETNPCSTISPNAQGISVVQ----SRNSPDVKSIRMTQPTSSSKGDLQSNKQCV-------GGSH 467

  Fly   547 FQ--------PFSTQKQSQTENEKTTQENGRGGSPAPAENNSN---SNSSTLYND---------- 590
            .:        |..:.:||.....:.||.         ||::.|   .|||.|..|          
 Frog   468 HEGVARPVGPPAVSLEQSMGTGVEDTQS---------AESSLNILGMNSSPLVEDISAEQSLDFS 523

  Fly   591 NENPKTKKQ------------RQALLQRNLTEQHRMQQDDEPPKNHTSPAMPPPSPQSNSSSSSS 643
            ..|.::|:|            ::|||..::......|....|..:.::.:.||.:..||::.:.|
 Frog   524 RANNRSKEQPKCFPEGNCTSPQKALLNLDIKSIEVPQVMQAPCTSQSADSFPPAAQCSNTAVAQS 588

  Fly   644 SSS--SANTHSSQSSHAVNNIPKPEINNKATTDTPASPALVEQGDIDAKPAVSVHECDEEEEPAV 706
            :.|  :.:|.::||| ..:||      ...|....|:.:.|.      :|.|.  ||..      
 Frog   589 TRSPRTKDTTAAQSS-CFSNI------RNTTAAQHANSSQVH------RPLVG--ECPS------ 632

  Fly   707 NKVSPAHPDPPTTAAVAAPPATESPKKSSPAANSE-----------SCPFG------------EV 748
               ||:.|..|.|:.:..|.....|..|.|:..||           :.||.            |.
 Frog   633 ---SPSGPRAPATSDLVTPENDSHPSNSVPSGGSEVSAVLCDTENRNGPFAGTDTSTKVAILQEY 694

  Fly   749 EDKLEQMFAGIEEETERISSPEKPAEESAAMVAHNLTAQLALDPSKTLDTPAENQ 803
            :...:|||.|..:|.:......|...:...::..|:...:....:|.|...||||
 Frog   695 KRMRDQMFKGDLKEDDAKRFWNKIHTQDHRLLLENIENSVKSVSNKILSGEAENQ 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600
LOC733724XP_002935796.2 ePHD_PHF6_like 11..128 CDD:277143
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.