DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and Phf7

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_082225.1 Gene:Phf7 MGIID:1919088 Length:307 Species:Mus musculus

Alignment Length:148 Identity:36/149 (24%)
Similarity:58/149 (39%) Gaps:22/149 (15%)


  Fly  1148 HKRKRKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSENGFEVWLHEDCAV 1212
            |.|.||......::       .|...||...|.|..|....|.   :|:..:.. .:.:|..|.:
Mouse    10 HPRLRKTIRTKKVT-------QRKLSSSPVCLLCLQEPGDPEK---LGEFLQKD-NLCVHYFCLI 63

  Fly  1213 WSNDIHLIGAHVNGLDAAVWDSTRYQ--------CVLCQQTGASICCFQRCCKAAAHVPCGRSAN 1269
            .|:.:...|....||...:.:..:.:        |.:|::.||:|.|....|....|:|||:...
Mouse    64 LSSRLPQKGQPNRGLHGFMPEDIKREAVRASKKICFVCKKKGAAIRCQNDQCVQNFHLPCGQERG 128

  Fly  1270 WSLSE--EDRKVYCHLHR 1285
             .||:  .:.|.||..||
Mouse   129 -CLSQFFGEYKSYCRKHR 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 34/146 (23%)
Phf7NP_082225.1 ePHD_PHF7_G2E3_like 33..144 CDD:277139 27/116 (23%)
PHD_PHF7_G2E3_like 247..300 CDD:276971
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.