DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and TCF20

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_005641.1 Gene:TCF20 HGNCID:11631 Length:1960 Species:Homo sapiens

Alignment Length:1806 Identity:341/1807 (19%)
Similarity:550/1807 (30%) Gaps:677/1807 (37%)


  Fly     8 HPG-HLSQAAQNASWNPL--QIPSYIPRQPQLAHMSNERPGMVRSPLAWHVSGTVSAQPPPPPDA 69
            ||. |:.|....|:..||  |:..|  .||::.         ||||:.:|.:.:..:.|.|....
Human   323 HPSQHVMQYTNAATKLPLQSQVGQY--NQPEVP---------VRSPMQFHQNFSPISNPSPAASV 376

  Fly    70 IYN------------------------FMSANHKNLDHHHQMNP---LLAPPYS----------- 96
            :.:                        .|.:.::.|....|::|   ::..|.|           
Human   377 VQSPSCSSTPSPLMQTGENLQCGQGSVPMGSRNRILQLMPQLSPTPSMMPSPNSHAAGFKGFGLE 441

  Fly    97 ----------------------GTLPFNSMDLSLQSARSAAQPLAKQPPNQQP------HQTQQQ 133
                                  ..||.....:.|..|.:..:..:|:|.:.:.      .:...|
Human   442 GVPEKRLTDPGLSSLSALSTQVANLPNTVQHMLLSDALTPQKKTSKRPSSSKKADSCTNSEGSSQ 506

  Fly   134 QQSLIHAPNYPS---------------IQNLTTNATPTSTQLQ--------------QQQQQEHL 169
            .:..:.:|...|               ::.|:..:|.:.|..:              .|.:...|
Human   507 PEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTTYKGGASEKAGSSPAQGAQNEPPRL 571

  Fly   170 AAMAAAH-------------------------VSLLQSSRQNQG---APSGN------------- 193
            .|..||.                         |.::.|.....|   .|.|.             
Human   572 NASPAAREEATSPGAKDMPLSSDGNPKVNEKTVGVIVSREAMTGRVEKPGGQDKGSQEDDPAATQ 636

  Fly   194 --LSNGGDCE----SLLPPPPPTSVSGNTNHTGSNSSSNSGSNN----HIASPHYMQSRDENFKL 248
              .||||..|    ||..|.||.......|..|.|:|:::|..|    |.|:.....||.|..|.
Human   637 RPPSNGGAKETSHASLPQPEPPGGGGSKGNKNGDNNSNHNGEGNGQSGHSAAGPGFTSRTEPSKS 701

  Fly   249 T-QLKRSFEPDLSGKNPQKEKDF-GYPSASSASKLPTHNVQQQHANKKPS----PLRNYHQQQQP 307
            . .|:.|::.......|:....| .||:.........|..::....|.||    .|:.||.....
Human   702 PGSLRYSYKDSFGSAVPRNVSGFPQYPTGQEKGDFTGHGERKGRNEKFPSLLQEVLQGYHHHPDR 766

  Fly   308 PYN-LTPKYNGPQTPPTPQSPLAAN------PHQMLSPTMDYNQLHLHHQLNSSSGGSYQHMQQD 365
            .|: .|.::.|          :|.:      |:.::|.|   |:|.....||.|.|         
Human   767 RYSRSTQEHQG----------MAGSLEGTTRPNVLVSQT---NELASRGLLNKSIG--------- 809

  Fly   366 QTQSQSHPQHLHYHNQHATSQTAPPPLLPPLLTS----GQFHAQPQDASQQQTASSSQHQT---- 422
                 |..::.|:......|.:..|.:....||.    .:|..:||.::.:...|.|:.::    
Human   810 -----SLLENPHWGPWERKSSSTAPEMKQINLTDYPIPRKFEIEPQSSAHEPGGSLSERRSVICD 869

  Fly   423 -----------------HHSRTAQLTNLD-------------------------QAVKHKPESEE 445
                             |.|...::...|                         |:.:.|.|..|
Human   870 ISPLRQIVRDPGAHSLGHMSADTRIGRNDRLNPTLSQSVILPGGLVSMETKLKSQSGQIKEEDFE 934

  Fly   446 Q------------------PVITDLSYRNSETDKTA------------ANPVP------------ 468
            |                  |.|...|||.:.:...|            :.|.|            
Human   935 QSKSQASFNNKKSGDHCHPPSIKHESYRGNASPGAATHDSLSDYGPQDSRPTPMRRVPGRVGGRE 999

  Fly   469 ----EAPE--------------------------SPYLTTS--------------NEESLESNSN 489
                .:|.                          :|::|.|              |.|:|.|..:
Human  1000 GMRGRSPSQYHDFAEKLKMSPGRSRGPGGDPHHMNPHMTFSERANRSSLHTPFSPNSETLASAYH 1064

  Fly   490 SS-------------NSRKRRKRKASMVMRVTPNE------NAPEGENSKPQHPQQAANLNNSCS 535
            ::             ||:...||:   :.:..|.|      .:.:|..:..||.|:        .
Human  1065 ANTRAHAYGDPNAGLNSQLHYKRQ---MYQQQPEEYKDWSSGSAQGVIAAAQHRQE--------G 1118

  Fly   536 PKKSPKNGGGEFQPFSTQKQSQTENEK---------------TTQENGRGGSPAPAENNSNSNSS 585
            |:|||:.     |.|..:.:|..:|:|               :.||.||          ...:|.
Human  1119 PRKSPRQ-----QQFLDRVRSPLKNDKDGMMYGPPVGTYHDPSAQEAGR----------CLMSSD 1168

  Fly   586 TLYNDNENPKTKKQRQALLQRNLTEQHRMQQDDEPPKNHTSPAM-------PPPSPQSNSSSSSS 643
            .|.|.....|...|:   ||.:..:   :.:...|.|:...|.|       ||.....:..:.::
Human  1169 GLPNKGMELKHGSQK---LQESCWD---LSRQTSPAKSSGPPGMSSQKRYGPPHETDGHGLAEAT 1227

  Fly   644 SSSSANT----------HSSQS--------SHAVNNIP----KPEINNKATTDTPASPALVEQGD 686
            .||...:          ||||:        ...::.||    ..::.|.:|.|         :|.
Human  1228 QSSKPGSVMLRLPGQEDHSSQNPLIMRRRVRSFISPIPSKRQSQDVKNSSTED---------KGR 1283

  Fly   687 IDAKPAVSVHECDEEEEPAVNKVSPAHPDPPTTAAVAAPPATESPKKSSPAANSESCPFGEVED- 750
            :       :|...|..:.|.|  |.||..  .:..:.:.|..:| .|..|:.:|.:||...:.. 
Human  1284 L-------LHSSKEGADKAFN--SYAHLS--HSQDIKSIPKRDS-SKDLPSPDSRNCPAVTLTSP 1336

  Fly   751 --------------KLEQMFAGIEEETERISSPEKPAEESAAMVAHNLTAQLALDPSKTLDTPAE 801
                          |||.:...|.....|.|:....||.....|              |||.   
Human  1337 AKTKILPPRKGRGLKLEAIVQKITSPNIRRSASSNSAEAGGDTV--------------TLDD--- 1384

  Fly   802 NQTSVLAVLAPNQTPTPEIRPVAT--------KAAMKSTMPSP------VHSPIPQSRSTSTPLV 852
                   :|:....| ||...||.        |..:.|.:.||      |..|:|:|   |....
Human  1385 -------ILSLKSGP-PEGGSVAVQDADIEKRKGEVASDLVSPANQELHVEKPLPRS---SEEWR 1438

  Fly   853 AGDDSKSNTPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRKKKVTKEPD------- 910
            ...|.|..|...|:.....:.||..::             ...::|||..:   ..||       
Human  1439 GSVDDKVKTETHAETVTAGKEPPGAMT-------------STTSQKPGSNQ---GRPDGSLGGTA 1487

  Fly   911 ---FEDD-DKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGKK-----GSAGK--- 963
               |.|. :.|.....|..|....:..|..:.|.|....|...|.....|||     ||..|   
Human  1488 PLIFPDSKNVPPVGILAPEANPKAEEKENDTVTISPKQEGFPPKGYFPSGKKKGRPIGSVNKQKK 1552

  Fly   964 --------------------GNAKNAKQNGKKSARKPAFTTDEDSTPAPTNGGGSVPELRFKSPF 1008
                                |..|..||..::..|||.      :.|.......:||.:..:.|.
Human  1553 QQQPPPPPPQPPQIPEGSADGEPKPKKQRQRRERRKPG------AQPRKRKTKQAVPIVEPQEPE 1611

  Fly  1009 ILIK----PDGSVSIKNTH--------------------SAEDVNEKQTKVKKAPHERKNLRGMH 1049
            |.:|    |......||..                    :||:  |:|||:.:....:::|....
Human  1612 IKLKYATQPLDKTDAKNKSFYPYIHVVNKCELGAVCTIINAEE--EEQTKLVRGRKGQRSLTPPP 1674

  Fly  1050 SSTLSNRYDADT--------TDST----WICVFCKRGPHKLGLGDLFGP-----YLVT------- 1090
            |||.|....|.:        |:|:    .:|..|.:......:||||||     |..|       
Human  1675 SSTESKALPASSFMLQGPVVTESSVMGHLVCCLCGKWASYRNMGDLFGPFYPQDYAATLPKNPPP 1739

  Fly  1091 SDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQ--ERNLPAVPATLANIMQAPKISMHKRKRK 1153
            ....|.::.|:.......:|...:....|:..:.|  :|:|.|.|                 :.|
Human  1740 KRATEMQSKVKVRHKSASNGSKTDTEEEEEQQQQQKEQRSLAAHP-----------------RFK 1787

  Fly  1154 QTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSENGFEV-------------- 1204
            :.|.|........:.||.........:.|:|...:::...:..|||.|.|:              
Human  1788 RRHRSEDCGGGPRSLSRGLPCKKAATEGSSEKTVLDSKPSVPTTSEGGPELELQIPELPLDSNEF 1852

  Fly  1205 WLHEDCAVWSNDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSAN 1269
            |:||.|.:|:|.|:|:...:.||..|:..:...:|..||:.||::.|:.:.|....|.||...|:
Human  1853 WVHEGCILWANGIYLVCGRLYGLQEALEIAREMKCSHCQEAGATLGCYNKGCSFRYHYPCAIDAD 1917

  Fly  1270 WSLSEEDRKVYCHLHRHEPGVVEPIKTESIAPVEVSVATPPAPAP-PPAFN 1319
            ..|.||:..|.|..|:                       ||.|.| ||..|
Human  1918 CLLHEENFSVRCPKHK-----------------------PPLPCPLPPLQN 1945

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 58/244 (24%)
TCF20NP_005641.1 Leucine-zipper 1170..1191 6/27 (22%)
Nuclear localization signal. {ECO:0000250} 1254..1268 2/14 (14%)
Nuclear localization signal. {ECO:0000250} 1576..1600 7/30 (23%)
ePHD_TCF20 1705..1932 CDD:277169 58/244 (24%)
Nuclear localization signal. {ECO:0000250} 1785..1792 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112723937
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4715
Isobase 1 0.950 0 Normalized mean entropy S8124
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003562
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14955
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.