DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and phf11

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_021334650.1 Gene:phf11 ZFINID:ZDB-GENE-081104-417 Length:531 Species:Danio rerio

Alignment Length:426 Identity:85/427 (20%)
Similarity:153/427 (36%) Gaps:109/427 (26%)


  Fly   437 VKHKPESEEQPVITDLSYRNSETDKTAANPVPEAPESPYLTTSNEESLESNSNSSNSRKRRKRKA 501
            :|..|.|...|.......|..|...|....|       |..:.:...:|.|....|.       .
Zfish    93 IKRCPRSFHYPCAIKADARAIEDFSTGTYRV-------YCKSHDPNPIEINDEIDND-------V 143

  Fly   502 SMVM----RVTP----NENAPEGENSKPQHPQQAANLNNSCSPKKSPKNGGGEFQPFSTQKQSQT 558
            .:|:    :..|    |::.|:.|.::|....:        :|.|:..|||    ..|.|:...|
Zfish   144 DLVLASVEKHVPAEQHNQSTPDPERTRPSEEVK--------TPAKASSNGG----LTSDQRSCGT 196

  Fly   559 ENEKTTQENGRGGSPAPAENNSNSNSSTL-YNDNENPKTKKQRQALLQRNLTEQHRMQQDDEPPK 622
            .:::..:.:.:..||.............| |.|||||.:   ..|::...::........::|  
Zfish   197 ADKRRIECDSQEHSPEHKTPTKKKKKRRLEYPDNENPTS---ADAVMAPEVSAPEESMTVNQP-- 256

  Fly   623 NHTSPAMPPPSPQS----NSSSSSSSSSSANTHSSQSSHAVNNIPK------PEINNKATTDTPA 677
            ||::|.  |.:.:|    |.|::.:::...:..:...|.:::.:.|      .|..:..|.:|..
Zfish   257 NHSTPL--PENTRSCEKLNLSTTGAAADDEDDETDIESVSLSVLNKTHLRHIEESQSVLTYETDP 319

  Fly   678 SPALVEQGDIDAKPA----VSVHECDEEEEPAVNKVSPAH-------PDPPTTAAVAAPPATESP 731
            .|.:|   .:|:.|:    :|:..|.....      ||||       .:..|.....:|..|.:|
Zfish   320 VPCIV---ILDSGPSLESEISLESCSSRNP------SPAHEFVTVPKQEKITPTDRTSPAQTVTP 375

  Fly   732 KKSSPAANSESCPFGEVEDKLEQMFAGIEEETERIS-----SPEKPAEESAAMVAHNLT-AQLAL 790
            :  .||.|.                       :|:|     ||:.|:..:...::...| ||.|:
Zfish   376 Q--VPAPNQ-----------------------KRVSDGPSVSPQHPSPTAGLRISAVCTLAQSAI 415

  Fly   791 DPSKTLDTPAENQTSVLAVLAPNQTPTPEIRPVATK 826
            ...:..|.|||..||      .:|:..|..:..|.|
Zfish   416 KKEQLSDPPAEVSTS------DSQSTVPNCQTRAAK 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600
phf11XP_021334650.1 ePHD_PHF6_like 14..128 CDD:277143 9/42 (21%)
Herpes_BLLF1 <228..445 CDD:330317 54/264 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.