DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and kmt2bb

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_002664717.2 Gene:kmt2bb ZFINID:ZDB-GENE-080521-1 Length:3772 Species:Danio rerio

Alignment Length:1214 Identity:242/1215 (20%)
Similarity:401/1215 (33%) Gaps:366/1215 (30%)


  Fly   178 SLLQSSRQNQ----GAPSGNLS-NGG---DCESLLP-PPPPTS----VSGNTNHTGSNSSSNSGS 229
            |.|:|.::.|    |.....:| |||   .|..|.| ...|.|    :..:....|....|:|||
Zfish    37 SRLRSEKRWQLGRCGTDLDEISANGGPRPTCLVLAPNEDQPLSRLLGLEASYKRLGEAGYSSSGS 101

  Fly   230 NNHIASPHYMQSRDENFKLTQLKRSFEPDLSGKNPQKEKDFGYPSASSASKLPTHNVQQQHANKK 294
            ..        .|..:.|::....||. |..:|:||.|.   |..|..|:.:     ::|:.|   
Zfish   102 EE--------GSEFKGFEVQNENRSI-PVRAGRNPCKR---GRVSVKSSKR-----IRQRLA--- 146

  Fly   295 PSPLRNYHQQQQPPYNLTPKYNGPQTPPTPQSPL--AANPHQMLSPTMDYNQLHLHHQLNSSS-- 355
                                        .|.|||  :...|...:.:....|||.......:|  
Zfish   147 ----------------------------LPVSPLVESTGSHDPQNDSGTVQQLHSQESQKDTSVD 183

  Fly   356 -GGSYQHMQQDQTQSQSHPQHLHYHNQHATSQTAPPPLL-----PPLLTSGQFHAQP-------- 406
             ||.......|...:...|......::...:||.|...:     ..::|......:|        
Zfish   184 DGGGGGGGGDDVDGALEKPTRRKRGSRKRETQTTPRITIKLVAKKTVVTVPTLRRKPGRRPKEVK 248

  Fly   407 QDASQQQTAS-SSQHQTHHSRT------AQLTNLDQAVKHKPESEEQPVIT-----------DLS 453
            .:.|:.|.|. ||.|....::|      |..|.::...:.:..|.:|.:.|           |..
Zfish   249 TEVSESQCAQISSAHVKLKTKTPASESSAGDTKVEVCTRRRGRSADQKLETTLQKEPKKEANDQK 313

  Fly   454 YRNSETDKTAANPVPEAPESPYLTTSNEESLESNSNSSNSRKRRKRKASMVMRVTPNENAPEGEN 518
            .:..::.:...||:|...:.|   ...::|.:..|..:....||:|..|   .:.|.|:   |:.
Zfish   314 LKLRKSTRKCQNPLPSENKEP---KPADKSAQEASEVNKLVIRRQRTRS---SIAPQES---GDQ 369

  Fly   519 SKPQHPQQAANLNNSCSPKKSPKNGGGEFQPFSTQKQSQTENEKTTQENGRGGSPAPAENNSNSN 583
            |..:...:.:.::.|.||.|..|           :|:.:.:|.|.::.|    ..:.|:::.:|.
Zfish   370 SLAESQLEVSTIDESRSPSKKKK-----------KKKKKKKNRKESERN----KDSSAKDHGHSA 419

  Fly   584 SSTLY----ND-----------NENPKTK-----------------KQRQALLQRNLTE-QHRMQ 615
            ...|.    ||           ..|||.:                 |.:.:.:|.||:: |....
Zfish   420 DDPLKLAFGNDFVGIPGLKLTRIRNPKARSRKKRCKFVWTLTLVKCKGKDSHIQENLSKTQDPQN 484

  Fly   616 QDD----------------EPPKNHTSPA----MPPPSPQ-----SNSSSSSSSSSSANTHSSQS 655
            |:|                .|.|...||:    :||...:     ..:..:|:.||:..|.|.|.
Zfish   485 QEDLGKTQEIESQDSRVQKSPSKADESPSIEAELPPKCDKEVDVSEEAEPASAPSSTLETDSLQE 549

  Fly   656 SHAVNNIPKPEINNKATTDTPASP------------------ALVEQGDIDAKPAVSVHECDEEE 702
            |.        ::.|.|:|..|.||                  .::|:.:|:|.|..:.   ..|.
Zfish   550 SQ--------KVENTASTVIPESPENPVAIDKDEEIPEKENEEVLERSEIEAHPEEAT---QTEP 603

  Fly   703 EPAVNKVSPAHPD--PPTTAAVAAPP--------------ATESPKKSSP--------AANSE-- 741
            |..:||      |  ||....|.:.|              .|.||:.:.|        ..|||  
Zfish   604 EDLINK------DIVPPLQIKVVSSPGKNNSLKQSFLIQQVTTSPEITEPEKVEEHQHLENSENM 662

  Fly   742 -----SCPFGEVEDKLEQMFA---------------------GIEEETERISSPEKPAEESAAMV 780
                 :.|..:|.:||.|..|                     ..|.....|::..:|.||...::
Zfish   663 LQKTTTSPDHKVRNKLHQSAARKKRARHRHWTIYRRKGRTNPSQENSASEIATETEPQEEELLVL 727

  Fly   781 AHNLTAQLALDPSKTLD--TPAENQTSVLAVLAPNQTPTPEIRPVATKAAMKSTM--PS----PV 837
            ...:.|.:...|.:.||  ||...:.||    .|...|.||   .|....::.|:  ||    ||
Zfish   728 PTEVPAPVESKPKRHLDKITPKRGKRSV----PPTAEPLPE---AAEPQVIEQTVEAPSTDLLPV 785

  Fly   838 HSPIPQSRSTSTPLVAGDDSKSNTPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRK 902
            ..|.|:.: ...|.:..::.....|.....|..|||..||:.   .|...|..:.....|....:
Zfish   786 TEPQPEIK-LEAPSIENEEVLVLEPSVKDHPQVRRPLKRRIK---HAKRRRRSLIGRRVKNQKLQ 846

  Fly   903 KKVTKEPDFEDDDKPSTSAAAAAALAARQLSEAAS-------ATKSKPAAGAKKKNAGVKGKKGS 960
            |||..||  .|...|:|.            ||...       |||.|.......::...:.||..
Zfish   847 KKVLVEP--TDGCPPTTE------------SEGGEPKLVGLFATKYKRKRITSIQSLEARRKKAK 897

  Fly   961 AGKGNAKNAKQNGKKSARKP----AFTTDEDSTPAPTNGGGSVPELR--------------FKSP 1007
            ......:|.....:.|.::.    :..||:|....| |....|..:|              .|:|
Zfish   898 FLSKQLENTSSQDQLSTQEESDSFSVKTDQDHDIQP-NKAKIVKNIRHFIMPVVSARSSRVIKTP 961

  Fly  1008 FILIKPDGSVSIKNTHSAEDVNEKQTKVKKAPHERKN---LRGMHSSTLSNRYDADTTDSTWICV 1069
            ...:...|...:...:|.:.:..:....|..|.||..   .:........:..|.|.: |||...
Zfish   962 KRFMDDLGMSDLPRKNSQKKLGLQPKSKKSDPSERGEPGCFQSQDEEDNQSEIDLDLS-STWESK 1025

  Fly  1070 FCKRGPHKLGLGDLFGPYLVTSDCDEYRAAVQTPG---------AQDIDGMFVNKRRREDMVKGQ 1125
              .:.|..:   |||..   .....:.|:.::.||         ::|:...      .||:.|..
Zfish  1026 --PKSPDDI---DLFSE---EKQSGKRRSLLRDPGFKWGVLEPASEDVYSF------GEDLDKEL 1076

  Fly  1126 ERNLPAVPATLANIM-------------QAPKISMHKR-KRKQT 1155
            |..|.|...|:.:.:             |:.|:.::|: |.||:
Zfish  1077 ETLLSAKDFTVDSFLDPVQKKKSTKFKAQSSKLRLYKKLKLKQS 1120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 21/112 (19%)
kmt2bbXP_002664717.2 termin_org_DnaJ <455..>958 CDD:274808 113/546 (21%)
zf-CXXC 1407..1452 CDD:251032
PHD1_KMT2B 1654..1700 CDD:277064
PHD2_KMT2B 1702..1750 CDD:277066
PHD3_KMT2B 1787..1843 CDD:277068
Bromo_ALL-1 1857..1979 CDD:99925
ePHD_KMT2A_like 2081..2185 CDD:277134
FYRN 2233..2279 CDD:283589
DUF1421 2770..3107 CDD:284607
FYRC 3470..3555 CDD:295414
SET <3606..3772 CDD:225491
SET 3634..3754 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.