DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and si:ch211-165g14.1

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_689373.2 Gene:si:ch211-165g14.1 ZFINID:ZDB-GENE-131127-601 Length:672 Species:Danio rerio

Alignment Length:786 Identity:154/787 (20%)
Similarity:255/787 (32%) Gaps:275/787 (35%)


  Fly   624 HTSP-----AMPPPSPQSNSSSSSSSSSSANTHSSQS-----------SHAVNNIPKPEINNKAT 672
            ||:|     .:..||....:|.|.|.:.|.:.:..|:           :|...:||.|.||.   
Zfish    28 HTNPIEALDLVKKPSWCGLTSGSRSVNLSESCYIEQTPPHRPEPGETPAHDSYSIPLPLING--- 89

  Fly   673 TDTPASPALVEQGDIDAKPAVSVH-ECDEEEEPAV-------------------------NKVSP 711
              .|:...::.|.....:.....| |.:||||..|                         :.|..
Zfish    90 --MPSVAQILSQCSSTDQEFTDCHEEMEEEEEEEVLMQTKQCHKNAESVLENSILGGRIAHVVLE 152

  Fly   712 AHPDPPTTAAVAAPPATESPKKSSPAANSESCPFGEVEDKLEQMFAGIEEETERISSPEKPAEES 776
            .||....:..|.:..::..|:.||.|||:                         :.|....||::
Zfish   153 KHPQDIGSDTVFSKGSSFLPQDSSAAANT-------------------------LHSTSSAAEQT 192

  Fly   777 AAMVAHNLTAQLALDPSKTL--DTPAENQTSVLAVLAPNQ--TPTPEIRPVATKAAMKST----- 832
            |       ...||.:.:||.  .|.::..:.::.|...|.  |..|.:||..|...:..|     
Zfish   193 A-------IETLASECTKTSTESTSSDADSDIIEVPVSNSRCTTRPNLRPRPTSVIVSDTSGRTL 250

  Fly   833 -----------------MPSPVHSPIPQSRS---TSTPLVAGDDSKS------------------ 859
                             .|..|:|......:   |:...| |.:|||                  
Zfish   251 RSSRLKQQVDADHQMNFSPKNVNSVYTMDEAVFETANHRV-GSESKSLLSWMESVLIPISPEDSE 314

  Fly   860 ---NTPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRKKKVTKEPDFEDDDKPSTSA 921
               |:..|...|:        .|...::|:||         .|..::..:..|..::...||.| 
Zfish   315 QDTNSSFPKNFPS--------TSDAENSSILR---------SPENRRSSSSTPSHQERTPPSKS- 361

  Fly   922 AAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGKKGSAGKGNAKNAKQNGKKSARKPAFTTDE 986
                    |:.::.....:.||....||     :.|:.:.|....|      |:..|||     :
Zfish   362 --------RKRAKPRPKPRPKPRPKPKK-----QPKRAAPGPKTTK------KRRRRKP-----Q 402

  Fly   987 DSTP----APTNGGGSVPELRFK------------------SPFILIKPDGSVSIKNTHSAEDVN 1029
            .|.|    :|..     ||::.|                  .|:|.:: ..|.:|.|....|..:
Zfish   403 PSGPSSMFSPKE-----PEIKLKFANHKSEKKEVRTAVHCFVPYIRME-FSSCTIVNFREEEVAS 461

  Fly  1030 EKQTKVKKAPHERKNLRGMHSSTLSNRYDADT-TDSTWICVFCKRGPHKLGLGDLFGPY------ 1087
            :|.:::..:....|.     |.....|..:|. ...|..|..|....:..|||||.|||      
Zfish   462 KKGSQLADSGVIPKT-----SCLQLGRIGSDARLQETRFCCLCGSTGNVEGLGDLHGPYHRSGAH 521

  Fly  1088 -LVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATLANIMQAPKISMHKRK 1151
             :...|.....|..|.|...|:|.:       :.:..|.                    |..||:
Zfish   522 PVCKVDSSLPLALKQEPDCSDVDSL-------DSLEDGG--------------------SQVKRR 559

  Fly  1152 RKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSENGFEVWLHEDCAVWSND 1216
            ||:....|:..|..|.|.                                   |:||||::|:..
Zfish   560 RKENGCESLEESGAPGEH-----------------------------------WIHEDCSIWTAG 589

  Fly  1217 IHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANWSLSEEDRKVYC 1281
            :.|:...:.||:.|:..:....|..|.:.||::.||.:.|....|.||...:..:|:||:..:.|
Zfish   590 VFLVKGKLYGLEEAIRLAQESVCSFCNRVGATLGCFFKDCPQKYHFPCAVQSGSALNEENFTMRC 654

  Fly  1282 HLHRHE 1287
            ..|:::
Zfish   655 PKHKNK 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 50/223 (22%)
si:ch211-165g14.1XP_689373.2 PHD_SF 496..657 CDD:304600 50/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112726381
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003562
OrthoInspector 1 1.000 T596716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14955
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.