DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and PHF11

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001035533.1 Gene:PHF11 HGNCID:17024 Length:331 Species:Homo sapiens

Alignment Length:170 Identity:33/171 (19%)
Similarity:63/171 (37%) Gaps:39/171 (23%)


  Fly  1198 SENGFEVWLHEDCAVWSNDIHLIGAH------------VNGLDAAVWDSTRYQCVLCQQTGASIC 1250
            |||   :..||:|.::|:.  |:...            |..:...:....:.:|..|.:.||::.
Human    62 SEN---IAAHENCLLYSSG--LVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVG 121

  Fly  1251 CFQRCCKAAAHVPCGRSANWSLSEED--RKVY---CHLHRHEPGVVEPIKTESI-------APVE 1303
            |..:.|....|..|.:..: ::.:.|  |.:|   |..|...|.:.:..|...:       .|:.
Human   122 CDLKNCNKNYHFFCAKKDD-AVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLS 185

  Fly  1304 VSVATPPAPAPPPAF--------NIHSLPXVRVR-VQKCR 1334
            .:...||.......|        ..|:.. |:|. ::||:
Human   186 GNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCK 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 21/103 (20%)
PHF11NP_001035533.1 ePHD_PHF11 45..159 CDD:277182 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.