DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and AFF1

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001160165.1 Gene:AFF1 HGNCID:7135 Length:1218 Species:Homo sapiens

Alignment Length:1365 Identity:280/1366 (20%)
Similarity:471/1366 (34%) Gaps:388/1366 (28%)


  Fly    96 SGTLPFNSMDLSLQSARSAAQPLAKQPPNQQPHQTQQQQQSLIHAPNYP-----------SIQNL 149
            ||...:|. |.:|...|.      |:..||:.||.::.....|.....|           .|||:
Human    10 SGNSLYND-DRNLLRIRE------KERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNM 67

  Fly   150 TTNATPTSTQLQQQQQQEHLAAMAAAHVSLLQSSRQNQGAPSGNLSNGGDCESLLPPPP-PTSVS 213
            ..|         .::.:|.|:  ..:|...|.:|....|.|...|.  .|..|.:|... .|||.
Human    68 LGN---------YEEVKEFLS--TKSHTHRLDASENRLGKPKYPLI--PDKGSSIPSSSFHTSVH 119

  Fly   214 GNTNHTGSNSSSNSGSNNHIASPHYMQSRDENFKLTQLKRSFEPDLSGKNPQK--EKDFGYPSAS 276
            ..:.||.::...:.|:.:|  :|...|.|.|.......|....||.......:  ::.||    |
Human   120 HQSIHTPASGPLSVGNISH--NPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG----S 178

  Fly   277 SASKLPTHNVQQQHANKKPSPLRNYHQQQQPPYNLTPKYNGPQTPPTPQSPLAANPHQMLSPTMD 341
            |..|.........|....        ....|...|:|..:.| :|..|.||:.:| .|.|..|..
Human   179 SHHKKGDRRADGDHCASV--------TDSAPERELSPLISLP-SPVPPLSPIHSN-QQTLPRTQG 233

  Fly   342 YNQLHLHHQLNSSSGGSYQHMQQD---QTQSQSHPQHLHYHNQHATSQTAPPPLLPPLLTSGQ-- 401
            .::  :|...|:|.|.......:|   :...:..||..........|||.|||.||....:.|  
Human   234 SSK--VHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPPSQTFPPPSLPSKSVAMQQK 296

  Fly   402 --FHAQPQDASQQQTASSSQ----HQTHHSRTAQLTNLDQAVKHKPESEEQPVITDLSYRNSETD 460
              .:.:|.|...|..:.|.:    .:.:..:|.:.|:|....|.|        :|.|...:...:
Human   297 PTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAK--------LTKLKMPSQSVE 353

  Fly   461 KTAAN----------------PVP----------EAPESPYLT---------TSNEESLESNSNS 490
            :|.:|                |.|          |..:.|:.|         |.|::..:::|.:
Human   354 QTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKT 418

  Fly   491 -SNSRKRRKRKASMVMRVTPNENAPEGENSKPQHPQQAANLNNSCSPKKSPKNGGGEFQPFSTQK 554
             |||::.........::::.:|::...:.  |:.|.      :|.:|..:|::..   :|.::..
Human   419 HSNSQQGTSSMLEDDLQLSDSEDSDSEQT--PEKPP------SSSAPPSAPQSLP---EPVASAH 472

  Fly   555 QSQTENEKTTQENGRGGSPAPAENNSNSNSS-------TLYNDNENPKTKKQRQALLQRNLTEQH 612
            .|..|:|.|:..:    |.:.:|:.|:|:.|       |...:.|.|.|.|.:   |...||   
Human   473 SSSAESESTSDSD----SSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQ---LDNWLT--- 527

  Fly   613 RMQQDDEPPKNHTSPAMPPPSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKATTDTPA 677
            ::.|...||:...|...|...|:|..||.|::|         ..|:.:..|.|:.::||....|.
Human   528 KVSQPAAPPEGPRSTEPPRRHPESKGSSDSATS---------QEHSESKDPPPKSSSKAPRAPPE 583

  Fly   678 SPALVEQGDIDAKPAVSVHECDEEEEPAVNKVSPAHPDPPTTAAVAAPPATESPK---KSSPAAN 739
            :|          .|  ....|.:         |||..:||....|    .|:.||   |:|..|.
Human   584 AP----------HP--GKRSCQK---------SPAQQEPPQRQTV----GTKQPKKPVKASARAG 623

  Fly   740 SESCPFGEVEDKLEQMFAGIEEETERISSPEKPAEESAAMVAHNLTAQLALDPSKTLDTPAENQT 804
            |.:...||.|..|  :..|..::|    |.:||                   ..||...|.    
Human   624 SRTSLQGEREPGL--LPYGSRDQT----SKDKP-------------------KVKTKGRPR---- 659

  Fly   805 SVLAVLAPNQTPTPEIRPVATKAAMKSTMPSP---VHSP-----------------IPQSRSTST 849
                 .|.:..|.|.:.|.:.|...||::|:|   :..|                 :|.:.|...
Human   660 -----AAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGP 719

  Fly   850 P---------------LVAGDDSKSNTPVPAK-----APAPRRPPPRRLSMGMDASLLRFMIDDP 894
            |               :|..|..|...|:|.:     :|....|||:.|.:.:...||. .|..|
Human   720 PHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLS-RIPQP 783

  Fly   895 PAKKPGRKKKVTKEPDF-EDDDKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGKK 958
            |.|...::|...|:|.. :.......|:.:::.||.::..||.....:|.....|:    :|.:.
Human   784 PGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKE----IKSQS 844

  Fly   959 GSAGKGNAKNAK--------QNGKKSARKPAFTTDEDSTPAPTNGGGSVPELR---------FKS 1006
            .|:...:.:::|        |:.||....|...:.....||.       |.|:         .:.
Human   845 SSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAK-------PALKRSRREADTCGQD 902

  Fly  1007 PFILIKPDGSVSIKNTHSAEDVNEKQTKVKKAPHERKNLRGMHSSTLSNRYDADTTDSTWICVFC 1071
            |     |..:.|.|:.|....: .||.:|:.        :|..||:                   
Human   903 P-----PKSASSTKSNHKDSSI-PKQRRVEG--------KGSRSSS------------------- 934

  Fly  1072 KRGPHKLGLGDLFGPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATL 1136
               .||...||...|:.|.|                             :..|..:  |..|...
Human   935 ---EHKGSSGDTANPFPVPS-----------------------------LPNGNSK--PGKPQVK 965

  Fly  1137 ANIMQAPKISMHKRKRKQTHDSSISYSDDPNESRSQCSSV-DLLDC--STESKFVETFRGMGKTS 1198
            .:..||   .:|.|:.|:....:...:|...::.....:| ..::|  :|||:        .::|
Human   966 FDKQQA---DLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESE--------SQSS 1019

  Fly  1199 ENGFEVWLHEDCAVWSNDIHLIGAHVNGL----DAAVWDSTRYQCVLCQ--QTGASICCFQRCCK 1257
            ::.:        :|:|..:.|| ..:..|    ||......:...|||.  |:..::..|:  ||
Human  1020 KSAY--------SVYSETVDLI-KFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR--CK 1073

  Fly  1258 AAAHVPCGRSANWSLSEEDRKVYCHLHRHEPGVVEPIKTESIAPVEVSVATPPAPAPPPAFNIHS 1322
            ....:...|:.|... |...||   .....|.:.....|.|          |.:|.|.||.::.|
Human  1074 KDIAIKYSRTLNKHF-ESSSKV---AQAPSPCIARSTGTPS----------PLSPMPSPASSVGS 1124

  Fly  1323  1322
            Human  1125  1124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 41/225 (18%)
AFF1NP_001160165.1 AF-4 16..1211 CDD:282905 278/1360 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.