DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and KMT2A

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_011541131.1 Gene:KMT2A HGNCID:7132 Length:4005 Species:Homo sapiens

Alignment Length:1611 Identity:300/1612 (19%)
Similarity:481/1612 (30%) Gaps:619/1612 (38%)


  Fly   109 QSARSAAQPLAKQPPNQQPHQTQQQQQSLIHAPNYPSIQNLTTNATPTSTQLQQQQQQEHLAAMA 173
            |::.|...||...||..||..:.......:..|..|    |.:...|.||...|.:::..|....
Human   589 QTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIP----LASPFLPASTAPMQGKRKSILREPT 649

  Fly   174 AAHVSLLQSSRQNQGAPSGNLSNGGDCESLLPPP------PPTSVSGNTNHTGSNSSSNSGSNNH 232
            ....||..|..:.|...|...:.    |.|:..|      ||.....:.......|:|.:.::..
Human   650 FRWTSLKHSRSEPQYFSSAKYAK----EGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASAR 710

  Fly   233 IASPHYMQSRDENFKLTQLKRS--FEPDLSGKNPQKEKDFGYPSASSASKLPTHNVQQQHANKKP 295
            :.||.:..:|.:..|.:.|.|:  |.|  |..:.:..:....||..:::...:..|..:...:|.
Human   711 LFSPLHSGTRFDMHKRSPLLRAPRFTP--SEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKV 773

  Fly   296 -SPLRNYHQQQQPPYNLTPKYN-------GPQTPPT--------PQSPLAANPHQMLSPTMDYNQ 344
             ||:|:  :.:.|.:::..:..       .|.|||:        ..||||.:   .|:||..:..
Human   774 FSPIRS--EPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATS---ALNPTFTFPS 833

  Fly   345 LHLHHQLNSSSGGSYQHMQ--QDQTQSQSHPQHLHYHNQHATSQTAPPPLLPPLLTSGQFHAQPQ 407
                |.| :.||.|.:..|  :.||.:.:.|          .|.::|.||. |..|.|.      
Human   834 ----HSL-TQSGESAEKNQRPRKQTSAPAEP----------FSSSSPTPLF-PWFTPGS------ 876

  Fly   408 DASQQQTASSSQHQTHHSRTAQLTNLDQAVKHKPESEEQPVITDLSYRNSETDKTAANPVPEAPE 472
                         ||...|     |.|:|    ||        :|| ::.:.||:...       
Human   877 -------------QTERGR-----NKDKA----PE--------ELS-KDRDADKSVEK------- 903

  Fly   473 SPYLTTSNEESLE-SNSNSSNSRKRRKRKASMVMRVTPNENAPEGENSKP----QHPQQAANLNN 532
                ..|.|...| ...|...|||.:::|.|.:.  :.:...|.|..||.    :....:::...
Human   904 ----DKSRERDREREKENKRESRKEKRKKGSEIQ--SSSALYPVGRVSKEKVVGEDVATSSSAKK 962

  Fly   533 SCSPKKSPKNGGGEFQPFSTQKQSQTENEKTTQENGRG---------GSPAPA------------ 576
            :...|||..:..|......|...:.....|...:.|||         |..||:            
Human   963 ATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTP 1027

  Fly   577 -----ENNSNSNSSTLYNDNENPKTKKQRQALLQR------NLTEQHRMQQDDEPPKNHTSPAMP 630
                 :::::|..|.|...::.|.|.|:..:||::      .:.:...::|.|:|          
Human  1028 SSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQP---------- 1082

  Fly   631 PPSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKAT--TDTPASPAL--VEQGDI---- 687
                  .:....|.||..:....:..|............:|.  .|.|...||  .|:..|    
Human  1083 ------KAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSM 1141

  Fly   688 --DAKPAVSVHECDEEEEPAVNKVSPAHPDPPTTAAVAAPPATESP--KKSSPAANSESCPFGEV 748
              |.|.:::   ..|:.||....:.|..|       |....|.:.|  ||...:.....||..:|
Human  1142 GNDDKSSIA---GSEDAEPLAPPIKPIKP-------VTRNKAPQEPPVKKGRRSRRCGQCPGCQV 1196

  Fly   749 EDKL--------EQMFAG------------------------IEEETERISSPEKPAEESAAMVA 781
            .:..        :..|.|                        ::::.:.:...||          
Human  1197 PEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEK---------- 1251

  Fly   782 HNLTAQLALDPSKTLDTPAENQTSVLA-VLAPNQTPTPEIR--PVATKAAMKSTMPSP------- 836
                      .|||.:.....::||:. |:..:|.|||..|  |...|:   |:.|.|       
Human  1252 ----------KSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKS---SSEPPPRKPVEEK 1303

  Fly   837 -----VHSPIPQSRSTSTPLVAGDDSKSNTPVPAKAPAPRRP---PPRRLSMGMDASLLRFMIDD 893
                 |.:|.|:|:..:||  |...|......||....|:.|   |||:       .:.:....:
Human  1304 SEEGNVSAPGPESKQATTP--ASRKSSKQVSQPALVIPPQPPTTGPPRK-------EVPKTTPSE 1359

  Fly   894 PPAKKP---------GRKKKVTKEPDFEDDDKPSTSAAAAAALAARQLSEAASATKSKPAAGAKK 949
            |..|:|         .::|||...|......||.                    .|.||....|:
Human  1360 PKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPK--------------------EKEKPPPVNKQ 1404

  Fly   950 KNAGVKGKKGSAGKGNAKNAKQNGKKSARK-PA---------FTTDEDSTPAPTNGG----GSVP 1000
            :|||..         |..:...||..|.:| ||         |..|.::......||    .|||
Human  1405 ENAGTL---------NILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVP 1460

  Fly  1001 ELRFKSPFILIKPDGSVSI----------------KNTHSAEDVNE------------------- 1030
             :..:....|....|.|..                :|....||..|                   
Human  1461 -ITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQA 1524

  Fly  1031 -------------------------KQTKVKK----------------APHERKNLRGMHSSTLS 1054
                                     |.||.||                .|.:..:.:..|..:|.
Human  1525 TKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLC 1589

  Fly  1055 NR-----------------YDADTTDS---------TWI-------------------------- 1067
            :.                 ||.|..:|         .|:                          
Human  1590 HDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVA 1654

  Fly  1068 --CVFC-KRGPH----------KLGLGDLFGPYL---VTSDCDEYRAAVQTPGAQ---------- 1106
              ||.| :|.|.          ::.|..:....|   .||....||.|.:.|...          
Human  1655 YTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSR 1719

  Fly  1107 -----------------------DIDGMFVNKRR------------REDMVK----------GQ- 1125
                                   |::|:   ||:            .:|:||          || 
Human  1720 SSPEGPDPPVLTEVSKQDDQQPLDLEGV---KRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQP 1781

  Fly  1126 -----------------ERNLPAVPATLANIMQAPKISMH--------------------KRKRK 1153
                             ||..|......:...:..|:|.:                    :.:.:
Human  1782 EIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREE 1846

  Fly  1154 QTH----------------------DSSI--------------SYSDDPN-------ESRSQCSS 1175
            .:|                      ||..              |..|.|.       |...||:.
Human  1847 NSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCAL 1911

  Fly  1176 VDLLDCSTESKFVETFRGMGKTSENGFEVWLHEDCAVWS------NDIHLIGAHVNGLDAAVWDS 1234
                 |.|...  ::....|:....|...|.|.:||:||      :|..|...|:     ||...
Human  1912 -----CLTYGD--DSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHM-----AVIRG 1964

  Fly  1235 TRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANWSLSEEDRKVYCHLHR 1285
            .:.:|..||:.||::.|....|.:..|..|.|:.| .:..:|:||||..||
Human  1965 KQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKN-CVFLDDKKVYCQRHR 2014

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 67/372 (18%)
KMT2AXP_011541131.1 zf-CXXC 1180..1227 CDD:251032 7/47 (15%)
PHD1_KMT2A 1466..1512 CDD:277063 7/46 (15%)
PHD2_KMT2A 1514..1563 CDD:277065 5/49 (10%)
PHD3_KMT2A 1601..1660 CDD:277067 7/59 (12%)
Bromo_ALL-1 1683..1813 CDD:99925 19/133 (14%)
ePHD_KMT2A 1907..2019 CDD:277163 35/122 (29%)
FYRN 2061..2107 CDD:283589
FYRC 3705..3788 CDD:197781
SET <3861..4005 CDD:225491
SET 3867..3987 CDD:214614
PostSET 3989..4005 CDD:214703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.