DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and trx

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_476769.1 Gene:trx FlyBaseID:FBgn0003862 Length:3726 Species:Drosophila melanogaster

Alignment Length:1380 Identity:288/1381 (21%)
Similarity:424/1381 (31%) Gaps:458/1381 (33%)


  Fly    31 PRQPQLAHMSNERPG---MVRSPLAWHVSGTVSAQPPPPPDAIYNFMSANHKNLDHHHQMNPLLA 92
            |.||||..:|....|   .::.|.....:.|        |.|.|..:.|.  |.|     ..::.
  Fly  2411 PAQPQLIAVSTNPDGTQQFIQIPQTMQATTT--------PTATYQTLQAT--NTD-----KKIML 2460

  Fly    93 PPYSGTLPFNSMDLSLQSARSAAQPLAKQ---------PPNQ---QPH--QTQQQQQSLIHAPNY 143
            |..:...|..::     :.::|.|...||         .|.|   |||  |.|||||:.:..|..
  Fly  2461 PLTAAGKPLKTV-----ATKAAQQAAVKQRQLKSGHQVKPIQAKLQPHPQQHQQQQQTQVQQPIT 2520

  Fly   144 PSIQNLTTNATPTSTQLQQQQQQEHLAAMAAAHVSLLQSSRQN----------QGAPSGNLS--N 196
            ...|||          ||.|...:......|..:.|.|:..||          ||.|...:|  .
  Fly  2521 VMGQNL----------LQPQLLFQSSTQTQAPQIILPQAQPQNIISFVTGDGSQGQPLQYISIPT 2575

  Fly   197 GGDCESLLPPPPPTSVSGNTNHTGSNSSSNSGSNNHIASPHYMQS-RDENFKLTQLKRSFEPDLS 260
            .|:.:   |.|.||:..     |...::..:|:.       |:|: ...|..||..         
  Fly  2576 AGEYK---PQPQPTATP-----TFLTTAPGAGAT-------YLQTDASGNLVLTTT--------- 2616

  Fly   261 GKNPQKEKDFGYPSASSASKLPTHNVQQQHANKKPSPLRNYHQQQ-----------QPPYNLTPK 314
                        ||.|....|...::|.|     |..:....|.|           ||..|..|.
  Fly  2617 ------------PSNSGLQMLTAQSLQAQ-----PQVIGTLIQPQTIQLGGGADGNQPGSNQQPL 2664

  Fly   315 YNGPQ---------TPPTPQSPLAANPHQMLSPTMDYNQLHLHHQLNSSSGGSYQHMQQDQTQSQ 370
            ..|..         ...:||..||..|......|:..|.:                |...|..|.
  Fly  2665 ILGGTGGGSSGLEFATTSPQVILATQPMYYGLETIVQNTV----------------MSSQQFVST 2713

  Fly   371 SHPQHLHYHNQHA-----TSQTAPPPLLPPL--LTSGQFHA-QPQDASQQQT----ASSSQHQTH 423
            :.|..|   :|:|     |:|......:.|:  |.:|.... ...|||...|    ||..|.||.
  Fly  2714 AMPGML---SQNASFSATTTQVFQASKIEPIVDLPAGYVVLNNTGDASSAGTFLNAASVLQQQTQ 2775

  Fly   424 HSRTAQ-LTNLDQAVKHKPESE----------------EQPVITDLSYRNSETDKTAANPVPEAP 471
            ...|.| |.|.:...:..|.|.                :.|.:|.:...|::......:.|.:.|
  Fly  2776 DDTTTQILQNANFQFQSVPTSSGASTSMDYTSPVMVTAKIPPVTQIKRTNAQAKAAGISGVGKVP 2840

  Fly   472 ESP-----YLTTS--NEESLESNSNSSNSRKRRKRKASMVMRVTPNENAPEGENSKPQHPQQAAN 529
            ..|     .|.||  .::|.....||:..:.:.|.||:.....|.  .||....|||.  |:..|
  Fly  2841 PQPQVVNKVLPTSIVTQQSQVQVKNSNLKQSQVKGKAASGTGTTC--GAPPSIASKPL--QKKTN 2901

  Fly   530 L-----NNSCSPKKSPKNGGGEFQPFSTQKQSQTENEKTTQENGRGGSPAPAENNSNSNSSTLYN 589
            :     .....||........:.|..|..:|.|.:..:..|:     .||...            
  Fly  2902 MIRPIHKLEVKPKVMKPTPKVQNQNHSLLQQQQQQQPQLQQQ-----IPAVVV------------ 2949

  Fly   590 DNENPK---------TKKQRQALLQRNLTEQHRMQQDDEPPKNHTSPAMP------PPSPQSN-- 637
             |:.||         .:.|:|.|.|..:....:.||..:..:....|:||      .|..||.  
  Fly  2950 -NQVPKVTISQQRIPAQTQQQQLQQAQMIHIPQQQQPLQQQQVQVQPSMPIITLAEAPVVQSQFV 3013

  Fly   638 ------------------SSSSSSSSSSA---------------NTHSSQSSHAVNNI------- 662
                              |:|||||||:.               :|.||.::...|.:       
  Fly  3014 MEPQALEQQELANRVQHFSTSSSSSSSNCSLPTNVVNPMQQQAPSTTSSSTTRPTNRVLPMQQRQ 3078

  Fly   663 -PKPEINNKATTDTPASPALVEQGDIDAKPAVSVHECDEEEEPAVNKVSPAH-----------PD 715
             |.|..|......:|..|..|||..|....:.||.:|..::....:.|..|.           ||
  Fly  3079 EPAPLSNECPVVSSPTPPKPVEQPIIHQMTSASVSKCYAQKSTLPSPVYEAELKVSSVLESIVPD 3143

  Fly   716 PPTTAAVAAPPATES------PKKSSPA----------------ANSESCPFGEVEDK----LEQ 754
            ....|.:...|.|||      .:|:||.                .|.:....|.:.||    :|.
  Fly  3144 VTMDAILEEQPVTESIYTEGLYEKNSPGESKTEQLLLQQQQREQLNQQLVNNGYLLDKHTFQVEP 3208

  Fly   755 MFAGI-------EEETE----------------RISSPEKPA-EESAAMVAHNLTAQLALDPSKT 795
            |...:       |||.|                .:|..|:|| ::..:.:..|||.....|...|
  Fly  3209 MDTDVYREEDLEEEEDEDDDFSLKMATSACNDHEMSDSEEPAVKDKISKILDNLTNDDCADSIAT 3273

  Fly   796 -----LDTPAENQ---TSVLAVLAPNQTPTPEIRPVATKAAMKST-----------------MPS 835
                 :|..|..|   ..|||..|....||.|.......||:::.                 :.:
  Fly  3274 ATTMEVDASAGYQQMVEDVLATTAAQSAPTEEFEGALETAAVEAAATYINEMADAHVLDLKQLQN 3338

  Fly   836 PVHSPIPQSRSTSTPLVAGDDSKSNTPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPG 900
            .|...: :.|......|:.:..:|...:...|.||..|.|               |.:|      
  Fly  3339 GVELEL-RRRKEEQRTVSQEQEQSKAAIVPTAAAPEPPQP---------------IQEP------ 3381

  Fly   901 RKKKVT-----KEPDFEDDDKPSTSAAA---AAALAARQLSEAASATKSKPAAGAKKKNAGVK-- 955
              ||:|     .|...||.....:|:..   .....|.|::..|......| .|......|::  
  Fly  3382 --KKMTGPHLLYEIQSEDGFTYKSSSITEIWEKVFEAVQVARRAHGLTPLP-EGPLADMGGIQMI 3443

  Fly   956 GKKGSAGK-------GNAKNAKQNGKKSARKPAFTTDEDSTPAPTNGGGSVPELRFKSPFILIKP 1013
            |.|.:|.|       |..|.:|...|...|....:|..:.......||.|.....          
  Fly  3444 GLKTNALKYLIEQLPGVEKCSKYTPKYHKRNGNVSTAANGAHGGNLGGSSASAAL---------- 3498

  Fly  1014 DGSVSIKNTHSAEDVNEKQTKVKKAPHERKNLRGMHSSTLSNRYDADTTDSTWICVFCKRGPHKL 1078
              |||..::|...|....|.::::                 |.||         |..|:      
  Fly  3499 --SVSGGDSHGLLDYGSDQDELEE-----------------NAYD---------CARCE------ 3529

  Fly  1079 GLGDLFGPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMV--KGQERNLPAVPATLANIMQ 1141
                   ||...|:.|.:.........|.|. :||.....| :|  :|...|||           
  Fly  3530 -------PYSNRSEYDMFSWLASRHRKQPIQ-VFVQPSDNE-LVPRRGTGSNLP----------- 3574

  Fly  1142 APKISMHKRKRKQTH 1156
               ::|..|..|:|:
  Fly  3575 ---MAMKYRTLKETY 3586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 20/92 (22%)
trxNP_476769.1 NR_DBD_like 762..>856 CDD:295381
PHD1_KMT2A_like 1268..1344 CDD:276981
PHD 1346..1390 CDD:214584
PHD3_KMT2A_like 1423..1479 CDD:276983
ePHD_KMT2A_like 1737..1841 CDD:277134
FYRN 1891..1935 CDD:283589
FYRC 3388..3476 CDD:197781 19/89 (21%)
SET 3590..3710 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.