DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and Tcf20

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_006242172.1 Gene:Tcf20 RGDID:1594486 Length:1992 Species:Rattus norvegicus

Alignment Length:1823 Identity:337/1824 (18%)
Similarity:543/1824 (30%) Gaps:709/1824 (39%)


  Fly     6 HPHPGHLSQAAQNASWNPL--QIPSYIPRQPQLAHMSNERPGMVRSPLAWHVSGTVSAQPPPPPD 68
            || |.|:.|....|:..||  |:..|  .||::.         ||||:.:|.:.:..:.|.|...
  Rat   355 HP-PQHVMQYTNAATKLPLQSQVGQY--NQPEVP---------VRSPMQFHQNFSPISNPSPAAS 407

  Fly    69 AIYN------------------------FMSANHKNLDHHHQMNP---LLAPPYS---------- 96
            .:.:                        .||:.::.|....|::|   ::..|.|          
  Rat   408 VVQSPSCSSTPSPLMQSGENLQCGQGNVSMSSRNRILQLMPQLSPTPSMMPSPNSHAAGFKGFGL 472

  Fly    97 -----------------------GTLPFNSMDLSLQSARSAAQPLAKQPP--------------N 124
                                   ..||.....:.|..|.:..:..:|:|.              :
  Rat   473 EGVPEKRLTDPGLSSLSALSTQVANLPNTVQHMLLSDALTPQKKTSKRPSSSSKKADSCTNSEGS 537

  Fly   125 QQPHQ----------------TQQQQQSLIHAPNYPSIQNLTT-------NATPTSTQLQQQQ-- 164
            .||.:                :.:.|...:...:..|..:.||       .|..:.||..|.:  
  Rat   538 SQPEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTTYKCGASEKAGSSPTQGAQNEAP 602

  Fly   165 -------QQEHLAAMAAAHVSLL--------------------------------QSSRQNQGAP 190
                   .:|..|:..|...||.                                :||:::..|.
  Rat   603 RLSTSPATREEAASPGAKDTSLSSEGNTKVNEKTVGVIVSREAMTGRVEKSGGQDKSSQEDDPAA 667

  Fly   191 SGN-LSNGGDCE---SLLPPPPPTSVSGNTNHTGSNSSSN-----SGSNNHIA-SPHYMQSRDEN 245
            |.. .||.|..|   :.||...|.......|..|.|:|||     :|.::|.| .|.:....:.:
  Rat   668 SQRPPSNSGVKEMSHTSLPQSDPLGGGSKGNKNGDNNSSNHNGEGNGQSSHSAVGPSFTGRTEPS 732

  Fly   246 FKLTQLKRSFEPDLSGKNPQKEKDF-GYPSASSASKLPTHNVQQQHANKKPS----PLRNYHQQQ 305
            .....|:.|::.......|:....| .|||........:|..::....|.||    .|:.||...
  Rat   733 KSPGSLRYSYKESFGSAVPRNVSGFPQYPSGQEKGDFGSHGERKGRNEKFPSLLQEVLQGYHHHP 797

  Fly   306 QPPYNLTPKYNGPQTPPTPQSPLA-----ANPHQMLSPTMDYNQLHLHHQLNSSSGGSYQHMQQD 365
            ...|        |::....|...:     |.|:.::|.|   |:|.....||.|.|...::....
  Rat   798 DRRY--------PRSAQEHQGMASGLEGTARPNILVSQT---NELTSRGLLNKSIGSLLENPHWG 851

  Fly   366 QTQSQSHPQHLHYHNQHATSQTAPP---------PLLPPLLTSGQFHAQPQDASQQQTASSSQ-- 419
            ..:.:|             |.|||.         |:      ..:|..:|..:|.:..||.|:  
  Rat   852 PWERKS-------------SSTAPEMKQINLSDYPI------PRKFEIEPSSSSHEPGASLSERR 897

  Fly   420 ------------------HQTHH-------SRTAQLT-NLDQAV------------------KHK 440
                              |...|       .|..:|. :|.|:|                  :.|
  Rat   898 SVICDISPLRQIVRDPGAHSLGHMGADARIGRNERLNPSLSQSVILPGGLVSMETKLKSQSGQIK 962

  Fly   441 PESEEQ----------------PV-ITDLSYRNSETDKTAAN--------------PVPEAP--- 471
            .|..||                |. |...:||.:.:...||:              |:...|   
  Rat   963 EEDFEQSKSQASFNKKSGDHCHPTSIKHETYRGNASPGAAAHDSISDYGPQDSRSTPMRRVPGRV 1027

  Fly   472 -------------------------------------ESPYLTTS--------------NEESLE 485
                                                 .:|::|.|              |.|||.
  Rat  1028 GSRETMRGRSSSQYHDFAEKLKMSPGRSRGPGGDPHHMNPHMTFSERANRSSLHAPFSPNSESLA 1092

  Fly   486 SNSNSS-------------NSRKRRKRKASMVMRVTPNE---NAPEGENSKPQHPQQAANLNNSC 534
            |..:::             ||:...||:.....:....:   ::.:|..:..||.|:        
  Rat  1093 SAYHTNTRAHAYGDPNTGLNSQLHYKRQMYQQQQEEYKDWASSSAQGVIAAAQHRQE-------- 1149

  Fly   535 SPKKSPKNGGGEFQPFSTQKQSQTENEK---------------TTQENGR-----GGSPAPAENN 579
            .|:|||:.     |.|..:.:|..:|:|               :|||.||     .|.||.:...
  Rat  1150 GPRKSPRQ-----QQFLDRVRSPLKNDKDGMMYGPPVGTYHDPSTQEAGRCLMSSDGMPAKSMEL 1209

  Fly   580 SNSNSSTLYNDNENPKTKKQRQALLQRNLTEQHRMQQDDEPPKNHTSPAM-------PPPSPQSN 637
            .:|:..                  ||.:..:   :.:...|.|:...|.|       ||..|..:
  Rat  1210 KHSSQK------------------LQESCWD---LSRQTSPAKSSGPPGMSNQKRYGPPHEPDGH 1253

  Fly   638 SSSSSSSSSSANT----------HSSQS--------SHAVNNIP----KPEINNKATTDT----- 675
            ..:.|:.||..:.          ||||:        ...::.||    ..::.|..|.|.     
  Rat  1254 GLAESTQSSKPSNVMLRLPGQEDHSSQNPLIMRRRVRSFISPIPSKRQSQDVKNSNTDDKGRLLH 1318

  Fly   676 PASPA----------LVEQGDIDAKP----AVSVHECDEEEEPAVNKVSPAHPD--PP------- 717
            |:...          |....||.:.|    :..:...|....|||...|||...  ||       
  Rat  1319 PSKEGADKVYNSYSHLSHSQDIKSIPKRDASKDLPNPDNRNCPAVTLTSPAKTKILPPRKGRGLK 1383

  Fly   718 ---TTAAVAAPPATES------------------------PKKSSPAANSESCPFGEVEDKLEQM 755
               ....:.:|....|                        |.:....||.|:    |:|.:..::
  Rat  1384 LEAIVQKITSPNIRRSASANSAETGGDTVTLDDILSLKSGPPEGGTVANQEA----EMEKRKGEV 1444

  Fly   756 FAGIEEETERISSPEKP-----------AEESAAMVAHNLTAQLALDPSKTLDT-----PAENQ- 803
            .:.:...|.:.|:.|||           .::.....||..||....:||.|:.:     |..|| 
  Rat  1445 VSDLVSATNQESNVEKPLPGPSEEWRGSGDDKVKTEAHVETASTGKEPSGTMTSTASQKPGGNQG 1509

  Fly   804 --TSVLAVLAP-------NQTP----TPEIRPVATKAAMKSTMPSPVHSP------IPQSRSTST 849
              ...|...||       |..|    |||..|...:....:.|.||....      .|..:....
  Rat  1510 RPDGSLGGAAPLIFPDSKNVAPVGILTPEANPKTEEKENDTVMISPKQESFPPKGYFPSGKKKGR 1574

  Fly   850 PLVAGDDSKSNTPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRKKKVTKEPDFEDD 914
            |:.:.:..|.....|   |.|.:||                                        
  Rat  1575 PIGSVNKQKKQQQQP---PPPPQPP---------------------------------------- 1596

  Fly   915 DKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGKKGSAGKGNAKNAKQNGKKSARK 979
                            |:.|                        ||| .|..|..||..::..||
  Rat  1597 ----------------QMPE------------------------GSA-DGEPKPKKQRQRRERRK 1620

  Fly   980 PAFTTDEDSTPAPTNGGGSVPELRFKSPFILIK----PDGSVSIKNTH----------------- 1023
            |.      :.|.......:||.:..:.|.|.:|    |......||..                 
  Rat  1621 PG------AQPRKRKTKQAVPIVEPQEPEIKLKYATQPLDKTDAKNKSFFPYIHVVNKCELGAVC 1679

  Fly  1024 ---SAEDVNEKQTKVKKAPHERKNLRGMHSSTLSNRYDADT--------TDST----WICVFCKR 1073
               :||:  |:|||:.::...:::|....|||.|....|.:        |:|:    .:|..|.:
  Rat  1680 TIINAEE--EEQTKLVRSRKGQRSLTPPPSSTESKVLPASSFMLQGPVVTESSVMGHLVCCLCGK 1742

  Fly  1074 GPHKLGLGDLFGPYLVTSDCDEYRAAV--QTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATL 1136
            ......:||||||:..    .:|.|.:  ..|..:..:.....|.|.:....|.:.:........
  Rat  1743 WASYRNMGDLFGPFYP----QDYAATLPKNPPPKRSTEMQNKVKVRHKSASNGSKTDTEEEEEQQ 1803

  Fly  1137 ANIMQAPKISMHKRKRKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSENG 1201
            ....:...::.|.| .|:.|.|........:.||.........:.|:|....:|...:..|||.|
  Rat  1804 QQQKEQRSLAAHPR-FKRRHRSEDCGGGPRSLSRGLPCKKAAAEGSSEKTASDTKPSVPTTSEGG 1867

  Fly  1202 FEV--------------WLHEDCAVWSNDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCF 1252
            .|:              |:||.|.:|:|.|:|:...:.||..|:..:...:|..||:.||::.|:
  Rat  1868 PELELQIPELPLDSNEFWVHEGCILWANGIYLVCGRLYGLQEALEIAREMKCSHCQEAGATLGCY 1932

  Fly  1253 QRCCKAAAHVPCGRSANWSLSEEDRKVYCHLHRHEPGVVEPIKTESIAPVEVSVATPPAPAP-PP 1316
            .:.|....|.||...|:..|.||:..|.|..|:                       ||.|.| ||
  Rat  1933 NKGCSFRYHYPCAIDADCLLHEENFSVRCPKHK-----------------------PPLPCPLPP 1974

  Fly  1317 AFN 1319
            ..|
  Rat  1975 LQN 1977

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 56/232 (24%)
Tcf20XP_006242172.1 ePHD_TCF20 1737..1964 CDD:277169 56/232 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112724019
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003562
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14955
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.