DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and Phf7

DIOPT Version :10

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001012211.1 Gene:Phf7 / 364510 RGDID:1308638 Length:380 Species:Rattus norvegicus


Alignment Length:163 Identity:40/163 - (24%)
Similarity:65/163 - (39%) Gaps:32/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1135 TLANIMQAPKISMHKRKRKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSE 1199
            |:....:.|::....|.:|.||             |...|....|.|..|....|.   :|:..:
  Rat     3 TIKEKKEHPRLRKTARTKKVTH-------------RKLSSGPVCLLCFQEPGDPEK---LGEFLQ 51

  Fly  1200 NGFEVWLHEDCAVWSNDIHLIGAHVNGL----------DAAVWDSTRYQCVLCQQTGASICCFQR 1254
            .. .:.:|..|.:.|:.:...|....||          :||  .::|..|.:|::.||:|.|.:.
  Rat    52 KD-NLCVHYFCLILSSKLPQKGQPNRGLHGFMPEDIKKEAA--RASRKVCFVCKRKGAAIRCQKD 113

  Fly  1255 CCKAAAHVPCGRSANWSLSE--EDRKVYCHLHR 1285
            .|....|:|||:... .||:  .:.|.||..||
  Rat   114 QCVQNFHLPCGQERG-CLSQFFGEYKSYCGKHR 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:473978 38/160 (24%)
Phf7NP_001012211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/19 (21%)
ePHD_PHF7_G2E3_like 33..144 CDD:277139 30/117 (26%)
Required for interaction and ubiquitination of the nucleosome core particle. /evidence=ECO:0000250|UniProtKB:Q9DAG9 67..92 5/26 (19%)
Required for interaction with ubiquitinated UBE2D2. /evidence=ECO:0000250|UniProtKB:Q9DAG9 150..306
Required for association with and ubiquitination of H3. /evidence=ECO:0000250|UniProtKB:Q9DAG9 243..300
PHD_PHF7_G2E3_like 246..299 CDD:276971
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.