DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and Phf7

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001012211.1 Gene:Phf7 / 364510 RGDID:1308638 Length:380 Species:Rattus norvegicus


Alignment Length:163 Identity:40/163 - (24%)
Similarity:65/163 - (39%) Gaps:32/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1135 TLANIMQAPKISMHKRKRKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSE 1199
            |:....:.|::....|.:|.||             |...|....|.|..|....|.   :|:..:
  Rat     3 TIKEKKEHPRLRKTARTKKVTH-------------RKLSSGPVCLLCFQEPGDPEK---LGEFLQ 51

  Fly  1200 NGFEVWLHEDCAVWSNDIHLIGAHVNGL----------DAAVWDSTRYQCVLCQQTGASICCFQR 1254
            .. .:.:|..|.:.|:.:...|....||          :||  .::|..|.:|::.||:|.|.:.
  Rat    52 KD-NLCVHYFCLILSSKLPQKGQPNRGLHGFMPEDIKKEAA--RASRKVCFVCKRKGAAIRCQKD 113

  Fly  1255 CCKAAAHVPCGRSANWSLSE--EDRKVYCHLHR 1285
            .|....|:|||:... .||:  .:.|.||..||
  Rat   114 QCVQNFHLPCGQERG-CLSQFFGEYKSYCGKHR 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 38/160 (24%)
Phf7NP_001012211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/19 (21%)
ePHD_PHF7_G2E3_like 33..144 CDD:277139 30/117 (26%)
PHD_PHF7_G2E3_like 246..299 CDD:276971
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.