DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and phf6

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_021336655.1 Gene:phf6 ZFINID:ZDB-GENE-030131-5278 Length:376 Species:Danio rerio

Alignment Length:264 Identity:60/265 (23%)
Similarity:93/265 (35%) Gaps:76/265 (29%)


  Fly  1093 CDEYRAAVQTPGAQDIDGMFVN--------KRRREDMVKGQERNLPAVPATLANIMQAPKISMHK 1149
            |.::|.|.| .|:.|..|:..|        .|.|....|.:.|.:                    
Zfish   139 CRKHRDASQ-DGSDDEQGVAANDSDSSPPRSRGRGRFEKSRIRGV-------------------- 182

  Fly  1150 RKRKQTHD--SSISYSDDPNESRSQCSSVDLLD-----------CSTESKFVETFRGMGKTSENG 1201
             .|.|:.|  |:.|..:|..||.|......|..           |....:..|| ||: ..|:|.
Zfish   183 -SRGQSDDTRSTSSQGNDDTESSSHRDRSPLRGSPGDSGLRCGFCHAGEEENET-RGV-LHSDNA 244

  Fly  1202 FEVWLHEDCAVWSN----------------DIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASIC 1250
            .:|..|..|.::|:                ||..:...:.       ...|.:|.||.|.||:|.
Zfish   245 KKVAAHYKCMLFSSGTVQLTTSSRAEFGNFDIKTVIQEIK-------RGKRMKCTLCAQLGATIG 302

  Fly  1251 CFQRCCKAAAHVPCG--RSANW--SLSEEDRKVYCHLHR-HEPGVVEPIKTESIAPVEVSV---A 1307
            |..:.|....|..||  ..|.:  :::....|:||..|. :|....|..:.||.:..:.::   |
Zfish   303 CEIKACVKTYHYHCGLQDKAKYIENMARGIYKLYCKNHSGNEERDEEDEERESRSREKAAIDNRA 367

  Fly  1308 TPPA 1311
            .||:
Zfish   368 DPPS 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 52/232 (22%)
phf6XP_021336655.1 PHD_SF 15..142 CDD:328929 1/3 (33%)
ePHD2_PHF6 223..340 CDD:277181 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.