DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and Kmt2a

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_017459029.1 Gene:Kmt2a RGDID:1586165 Length:4064 Species:Rattus norvegicus

Alignment Length:1601 Identity:300/1602 (19%)
Similarity:481/1602 (30%) Gaps:583/1602 (36%)


  Fly   109 QSARSAAQPLAKQPPNQQPHQTQQQQQSLIHAPNYPSIQNLTTNATPTSTQLQQQQQQEHLAAMA 173
            |::.|...||...||..||..........:..|..|    |.:...|.|....|.:::..|....
  Rat   636 QTSSSPPPPLLTPPPPLQPASGISDHTPWLMPPTIP----LASPFLPASAAPMQGKRKSILREPT 696

  Fly   174 AAHVSLLQSSRQNQGAPSGNLSNGGDCESLLPPP------PPTSVSGNTNHTGSNSSSNSGSNNH 232
            ....||..|..:.|...|...:.    |.|:..|      ||.....:.......|:|.|.::..
  Rat   697 FRWTSLKHSRSEPQYFSSAKYAK----EGLIRKPIFDNFRPPPLTPEDVGFASGFSASGSAASAR 757

  Fly   233 IASPHYMQSRDENFKLTQLKRS--FEPDLSGKNPQKEKDFGYPSASSASKLPTHNVQQQHANKKP 295
            :.||.:..:|.:..|.:.:.|:  |.|  |..:.:..:....||..::|...:..|..:...:|.
  Rat   758 LFSPLHSGTRFDIHKRSPILRAPRFTP--SEAHSRIFESVTLPSNRTSSGASSSGVSNRKRKRKV 820

  Fly   296 -SPLRNYHQQQQPPYNLTPKYN-------GPQTPPT--------PQSPLAANPHQMLSPTMDYNQ 344
             ||:|:  :.:.|.:::..:..       .|.|||:        |.|||||:   .|:||..:..
  Rat   821 FSPIRS--EPRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSIPVSPLAAS---ALNPTFTFPS 880

  Fly   345 LHLHHQLNSSSGGSYQHMQQDQTQSQSHPQHLHYHNQHATSQTAPP-----PLLPPLLTSGQFHA 404
                |.| :.||.|.:..|:.:.|               ||..|.|     |.|.|..|.|    
  Rat   881 ----HSL-TQSGESTEKSQRARKQ---------------TSAPAEPFSSNSPALFPWFTPG---- 921

  Fly   405 QPQDASQQQTASSSQHQTHHSRTAQLTNLDQAVKHKPESEEQPVITDLSYRNSETDKTAANPVPE 469
                   .||....:..|.....::..:.|::|: |.:|.|         |:.|.:|        
  Rat   922 -------SQTEKGRKKDTAPEELSKDRDADKSVE-KDKSRE---------RDREREK-------- 961

  Fly   470 APESPYLTTSNEESLESNSNSSNSRKRRKRKASMVMRVTPNENAPEGENSKPQHPQQAANLNNSC 534
                              .|...|||.:::|.|.:.  :.:...|.|..||.:...:....::|.
  Rat   962 ------------------ENKRESRKEKRKKGSDIQ--SSSALYPVGRVSKEKVAGEDVGTSSSA 1006

  Fly   535 S-----PKKSPKNGGGEFQPFSTQKQSQTENEKTTQENGRGG----------------------- 571
            .     .|.|..:.|.:..|. |...:.....|...:.|||.                       
  Rat  1007 KKATGRKKSSSLDSGADIAPV-TLGDTTAVKAKILIKKGRGNLEKNNLDLGPTAPSLEKEKTLCL 1070

  Fly   572 ---SPAPAENNSNSNSSTLYNDNENPKTKKQRQALLQR------NLTEQHRMQQDDEPPKNHTSP 627
               ||:..:::::|..|.|...::.|.|.|:..:||::      .:.:...::|.|:|       
  Rat  1071 STPSPSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQP------- 1128

  Fly   628 AMPPPSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKAT--TDTPASPAL--VEQGDI- 687
                     .:....|.||..:....:..|............:|.  .|.|...||  .|:..| 
  Rat  1129 ---------KAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKIL 1184

  Fly   688 -----DAKPAVSVHECDEEEEPAVNKVSP-----AHPDPPT-----TAAVAAPPATESPKKSSPA 737
                 |.|.:::..|..|...|.:..:.|     |..:||.     :......|..:.|:.....
  Rat  1185 SSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVC 1249

  Fly   738 ANSESCP-FGEVEDK--------------------LEQMFAGIEEETERISSPEKPAEESAAMVA 781
            .|....| ||....|                    |::....::::.::..:.||...:.:.:|.
  Rat  1250 TNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQTKAVKKKEKKSKATEKKESKESTVVK 1314

  Fly   782 HNL-TAQLALDPSKTLDT------------PAENQTSVLAVLAPNQTPTPEIRPVATKAAMKSTM 833
            .:| :||.|..|.:....            |.|.:|......||...|.|...|        :..
  Rat  1315 SSLESAQKAAPPVREEPAPKKSSSEPPPRKPVEEKTEEGGAPAPAPAPAPAPAP--------APA 1371

  Fly   834 PSPVHSPIPQSRSTSTPLVAGDDSKSNTPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKK 898
            |:|..:|.|:.:..|||  |...|......|| |..|.:||...|   ......:.:..:|..|:
  Rat  1372 PAPAPAPAPEPKQASTP--ASRKSSKQVSQPA-AVVPPQPPSTAL---QKKEAPKAIPSEPKKKQ 1430

  Fly   899 P---------GRKKKVTKEPDFEDDDKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKKNAGV 954
            |         .::|||...|......||.                    .|.||...:|::|||.
  Rat  1431 PPPPESGPEQSKQKKVAPRPSIPVKQKPK--------------------DKEKPPPVSKQENAGT 1475

  Fly   955 KGKKGSAGKGNAKNAKQNGKKSARK-PA---------FTTDEDSTPAPTNGG----GSVPELRFK 1005
            .         |..|...||..|.:| ||         |..|.::......||    .||| :..:
  Rat  1476 L---------NILNPLLNGISSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVP-ITPR 1530

  Fly  1006 SPFILIKPDGSVSI----------------KNTHSAEDVNE------------------------ 1030
            ....|....|.|..                :|....||..|                        
  Rat  1531 VVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLL 1595

  Fly  1031 --------------------KQTKVKK----------------APHERKNLRGMHSSTLSNR--- 1056
                                |.||.||                .|.:..:.:..|..:|.:.   
  Rat  1596 ECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAK 1660

  Fly  1057 --------------YDADTTDSTWI-CVFCKRGPHKL--GLGDLFGPYLVTS-----------DC 1093
                          ||.|..:|..: |..|.|..|..  ||.|..  |.:.|           :|
  Rat  1661 LFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCEGLSDEM--YEILSNLPESVAYTCVNC 1723

  Fly  1094 DE------------------------------------YRAAVQTPGAQ---------------- 1106
            .|                                    ||.|.:.|...                
  Rat  1724 TERHPAEWRLALEKELQASLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGP 1788

  Fly  1107 -----------------DIDGMFVNKRR-----------REDMVK----------GQ-------- 1125
                             |::|  |.|:.           .:|:||          ||        
  Rat  1789 DPPVLTEVSKQDEQQPLDLEG--VKKKMDQGNYVSVLEFSDDIVKIIQAAINSDGGQPEIKKANS 1851

  Fly  1126 ----------ERNLPAVPATLANIMQAPKISM---------------HKRKRKQTHDSSISYSDD 1165
                      ||..|......:...:..|:|.               |...:.|..:.| |:::.
  Rat  1852 MVKSFFIRQMERVFPWFSVKKSRFWEPNKVSNNSGMLPNAVLPPSLDHNYAQWQEREES-SHTEQ 1915

  Fly  1166 P--------------------------------NESRSQCSSVDL-----LDCSTESKFVETFRG 1193
            |                                :..||:..|.:|     :|.:.:......:  
  Rat  1916 PPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELHPPPGIDDNRQCALCLMY-- 1978

  Fly  1194 MGKTSEN--------GFEVWLHEDCAVWS------NDIHLIGAHVNGLDAAVWDSTRYQCVLCQQ 1244
             |..|.|        |...|.|.:||:||      :|..|...|:     ||....:.:|..||:
  Rat  1979 -GDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHM-----AVIRGKQLRCEFCQK 2037

  Fly  1245 TGASICCFQRCCKAAAHVPCGRSANWSLSEEDRKVYCHLHR 1285
            .||::.|....|.:..|..|.|:.| .:..:|:||||..||
  Rat  2038 PGATVGCCLTSCTSNYHFMCSRAKN-CVFLDDKKVYCQRHR 2077

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 70/403 (17%)
Kmt2aXP_017459029.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.