DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and Cobll1

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_008760157.1 Gene:Cobll1 RGDID:1308954 Length:1361 Species:Rattus norvegicus

Alignment Length:1160 Identity:226/1161 (19%)
Similarity:363/1161 (31%) Gaps:380/1161 (33%)


  Fly    60 SAQPPPPPD--------AIYNFMSANHKNLDH--HHQMNPLLA---PPY--SGTL--PFNSMDLS 107
            |.|....||        .|::|...:.|..:.  .....||::   |.:  |.|:  |:.|..|.
  Rat   295 SCQISHNPDIVKEKENKGIFSFFQRSKKKREQTASAPATPLVSKHRPSFTRSNTISKPYISNTLP 359

  Fly   108 LQSARSAAQPLAKQPPNQQPHQTQQQQQSLIH--------------------------------- 139
            ..:.:....||...|.:|...|.|:::.|.:.                                 
  Rat   360 SDAPKKRRAPLPPMPTSQGAAQGQERRASCVERSTSVDDTDKSSSEGFMVRTGSLQLSGSTSVGT 424

  Fly   140 ---------APNYPSIQNLTTNATPTSTQLQQQQQQEHLAAMAAAH------------VSLLQSS 183
                     ||..||..:||.....:|               ||||            :|.:.|.
  Rat   425 SSLKRTKRKAPAPPSKPSLTETDEGSS---------------AAAHGLPLEDGIVPDSISEVSSP 474

  Fly   184 RQNQGAPSGNLSNGGDCESLLPPPPPTSVSGNTNHTGSNSSSNSGSNNHIASPHYMQSRDENFKL 248
            .:..|..|..       |..:|.|......|......:.:|..||    ::|.:.::..||..:|
  Rat   475 EEGPGFLSQE-------ECSVPKPMDEISEGPGTPEAAVASMTSG----VSSDYSLEEIDEKEEL 528

  Fly   249 TQLKRSFEPDLSG--KNPQKEKDFGYPSAS-----SASKLPTHNVQQQHANKKPSPLRNYHQQQQ 306
            .:..:    |.:|  |:|.      ..|||     :|...|...:........|....|      
  Rat   529 MEASK----DQAGSVKSPT------IASASTDMIITAENDPDSALSISDGETSPGSKGN------ 577

  Fly   307 PPYNLTPKYNGP--QTPPTPQSPLAANPHQM---------LSPTMD---YNQLHL---------- 347
                 ||:...|  |.|..|...|..|.:.:         |||..:   .|::.:          
  Rat   578 -----TPEGRNPEGQGPHHPVECLIGNENNVSDSIKDLKTLSPNQESVIQNEVVVCATSTDYVKN 637

  Fly   348 ---------------------HHQLNSSSGGSYQHMQQDQTQSQSHPQHLHYHNQHATSQTAPPP 391
                                 ..:|:.|..|     :.|..||.        ...|.|:...|  
  Rat   638 RPREMEATIEGEAQKKVGDVEAERLSGSPAG-----RMDDVQSS--------RENHLTASPGP-- 687

  Fly   392 LLPPLLTSGQFHAQP-------QDASQQQTASSS----QHQTHHS------RTAQLTNLDQAVKH 439
                    .|...||       |||:.|.|.:.|    .|:.|:|      .|||......:.:|
  Rat   688 --------DQKSNQPRVEKTKMQDAAIQATPACSTFDGNHEAHNSPDLRVDETAQTLGSSTSTQH 744

  Fly   440 KPESEEQPVITDLSYRNSETDKTAAN--PVPEAPESPYLTTSNEESLESNSNSSNSRKRRKRKAS 502
            ...|.:..|......|:..|.....:  ||.||.    .|..|.::|.....|.      |..|:
  Rat   745 SSASFQDSVNASREVRSQGTSTYVQDRLPVKEAA----CTYGNNDALSPIDGSG------KNPAA 799

  Fly   503 MVMRVTP---NENAPEGENSKPQHPQQAANLNNSCSPKKSPKNGGGEF-----------QPFSTQ 553
            ..::..|   .:|.|:   .||         :|..:.:..||.|...:           :.:.::
  Rat   800 SSLKNFPLYRQDNHPK---PKP---------SNEITREYIPKIGMTTYKIVPPKSLEVVKDWDSE 852

  Fly   554 KQSQTENEKTTQENGRGGSPAPAENNSNSNSSTLYNDNENPKTKKQRQALLQRNLTEQHRMQQDD 618
            ...:.:|:||.         |.|:.::....:         :|..|.:||:....::|   .|.|
  Rat   853 AAGKKDNQKTL---------AVAQKHAIETMT---------ETAVQAEALVTSKNSQQ---PQPD 896

  Fly   619 EPPKNHTSPAMPPPSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKATTDT---PASPA 680
            ..||         ||..:......:.||...|..        |.|||.   :.||||   |.:|.
  Rat   897 RTPK---------PSSGTEHPLHRTVSSPVGTEM--------NPPKPP---RMTTDTGTIPFAPN 941

  Fly   681 LVEQGDI------------DAKPA---------VSVHECDEEEEPAVNKVSPAHPDPPTTAAVAA 724
            |.:..:|            .|||:         .|.|........:|:......|..||...|..
  Rat   942 LEDINNILESKFRSRASNPQAKPSSFFLQMQKRASGHYVTSAAAKSVHTAPGPTPKEPTIKEVQR 1006

  Fly   725 PPATESPKKSSP-AANSESCPFGEVEDKLEQMFAGIEEETERISSPEKPAEESAAMVAHNLTAQL 788
            .|.....:..|| :..:.|.|...:.          :.:..||   :||||.|...||       
  Rat  1007 DPQLPPEQCLSPLSERTHSAPLPNIS----------KADDNRI---QKPAETSPPPVA------- 1051

  Fly   789 ALDPSKTLDTPAENQTSVLA---VLAPNQTPTPEIRP----VATKAAMKSTMPSPVHSPIPQSRS 846
                .|.:..|||.....:|   :..|.:|..|.:.|    :.|:|:.....|.|:..|...|..
  Rat  1052 ----PKPMALPAETSPPAVAPKPMAFPAETSLPPVSPKPMALPTEASSSPISPKPMAPPAEASIP 1112

  Fly   847 TSTPLVAGDDSKSNTPVPAKAPAPRR-------PP--PRRLSMGMDASLLRFMIDDPPAKKP--- 899
            ...|......::: :|:|. ||.|..       ||  |:.:::..:||      ..|.|.||   
  Rat  1113 PVVPKPMAPPAEA-SPLPV-APKPMAFPAETSLPPVAPKPMALPTEAS------PPPVAPKPLAL 1169

  Fly   900 ----GRKKKVTKEPDFEDDDKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKKN----AGVKG 956
                |....:.....|......::||.:..|||..:.|:  |.:|:.|.:.::..:    |.::.
  Rat  1170 PGSQGASLNLKTLKTFGAPRPYNSSAPSPFALAVVKRSQ--SFSKASPESPSEDSSAQPPAAIQD 1232

  Fly   957 KKGSAGKGNAKNAKQNGKKSARKPAFTTDEDSTPAPTNGGGSV-----PELRFKS 1006
            .|..........::.:|.....||...........|.:|..|.     ..|.|:|
  Rat  1233 GKTQTVNQPTVGSQHDGVDKQNKPVQNEHSSQRLTPADGPSSFTLQRQSSLNFQS 1287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600
Cobll1XP_008760157.1 UBQ 120..189 CDD:294102
Cobl 204..280 CDD:286545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.