DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and Rai1

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_008766040.1 Gene:Rai1 RGDID:1308500 Length:1906 Species:Rattus norvegicus

Alignment Length:1779 Identity:333/1780 (19%)
Similarity:522/1780 (29%) Gaps:638/1780 (36%)


  Fly     6 HPHPGHLSQA---AQNASWNPLQIPSYIPRQPQLAHMSNERPGMVRSPLAWHVSGTVSAQPPPPP 67
            :.|.|...|.   |..|...|.|.  |....|..:|......|  |||       :.|:.|.|..
  Rat   293 YQHYGQQGQGYCPADTAVRTPEQY--YQTFSPSSSHSPARSVG--RSP-------SYSSTPSPLM 346

  Fly    68 DAIYNFMSANHK---------NLDHHHQMNPLLAPPYSGT------------------LPFNSM- 104
            ..:.||..:...         ..||.|.| |||.|..:..                  ||.|.: 
  Rat   347 PNLENFPYSQQPLSTGAFPTGITDHSHFM-PLLNPSPTDAASSVDPQVSNCKPLQKEKLPDNLLS 410

  Fly   105 DLSLQ-------------------------------------------------------SARSA 114
            |||||                                                       ||..|
  Rat   411 DLSLQSLTALTSQVENISNTVQQLLLSKATIPQKKGVKNLVSRTPEQHKSQHCSPEGSGYSAEPA 475

  Fly   115 AQPLAKQPPNQQPHQTQQQQQ--------------SLIH---APNYPSIQNLTTNATP------- 155
            ..||: :||:..|..|..:.|              |.::   |...|:..|..:.|.|       
  Rat   476 GTPLS-EPPSSTPQSTHAEPQDTDYLSGSEDPLERSFLYCSQARGSPARVNSNSKAKPESVSTCS 539

  Fly   156 ------TSTQLQQQQQQEH----------------------LAAMA----AAHVSLLQ------- 181
                  .||:.....|..|                      |:|:|    |:.:..||       
  Rat   540 VTSPDDMSTKSDDSFQSLHSTLPLDSFSKFVAGERDCPRLLLSALAQEDLASEILGLQEAIVEKA 604

  Fly   182 --------SSRQNQGAPSGNLSNGGDC--------------ESLLPPPPPTSVSGNTNHTGSNSS 224
                    |..::.|.|..:|.|...|              ...||.|......|:|..      
  Rat   605 DKAWAEASSLPKDNGKPPFSLENHSTCLDTVAKTSWSQPGEPEALPEPLQLDKGGSTKD------ 663

  Fly   225 SNSGSNNHIASPHYMQSRDENFKLTQLKRSFEP-------------------------------D 258
                     .||...:.....|..|..|::..|                               .
  Rat   664 ---------FSPGLFEDPSVAFATTDPKKTTSPLSFGTKPLLGTATPDPTTAAFDCFPDTTTASS 719

  Fly   259 LSGKNP----------------------QKEKDFGYPSASSASKLPTHNV------QQQHANKKP 295
            :.|.||                      .|..:.|..::.|..|...|..      |::||..||
  Rat   720 VDGANPFAWPEENLGDACPRWGLHPGELTKGLEQGAKASDSVGKADAHETSACLGFQEEHAIGKP 784

  Fly   296 -SPLRNYHQQQQ-------------------------------------------PP-------- 308
             :.|....:||:                                           ||        
  Rat   785 AAALSGDFKQQEADGVKEEVGGLLQCPEVGKADQWLEDSRHCCSSADFGDLPLLPPPGRKEDLEA 849

  Fly   309 ----YNLTPKYNGPQTPPTPQSPLAANPHQMLSPTMDYNQLHLHHQLNSSSGGSYQHMQQDQTQS 369
                .:|......|:..|:.|.||  :|...|..|.:    .....|::.:|             
  Rat   850 EEEYSSLCELLGSPEQRPSLQDPL--SPKAPLICTKE----EAEEVLDTKAG------------- 895

  Fly   370 QSHPQHLHYHNQHATSQTAPPPLLPPLL----------TSGQFHAQPQDASQQQTASSSQHQTHH 424
            .:.|.||         ...|..||.|.:          .|...|.:|.:..:.:.|..|. .|..
  Rat   896 WASPCHL---------SGEPAVLLGPSVGAESKVQSWFESSLSHMKPGEGPELERAPGSA-STSQ 950

  Fly   425 SRTAQLTNLDQAVKHKPESEEQPVITDLSYRNSETDKTAANPVPEAPESPYLTTSNEESLESNSN 489
            ...|...| ..||...|.::::||....|.|:....:    .:|||.:||....:..:.|....:
  Rat   951 GSLAPKPN-TPAVPEGPIAKKEPVPRGKSLRSRRVHR----GLPEAEDSPCRAPALPKDLLLPES 1010

  Fly   490 SSNSRKRRKRKASMVMRVTPNENAPEG----------ENSKPQHPQQAANLNNSCSPKKSPKNGG 544
            .:...:.:...|.     .|.....||          ..|:||.|...   ..:.:|....|.||
  Rat  1011 CTGPPQGQAEGAG-----APGRGLSEGLPRMCTRSLTALSEPQTPGPP---GLTTTPTPPDKLGG 1067

  Fly   545 GEFQPFSTQKQSQTENEKTTQENGRGGSPAPAENNSNSNSSTL-YNDNENP---KTK-------- 597
            .:...|.:.|              |.|.|:|...:|.||.:.| ...:.:|   |||        
  Rat  1068 KQRAAFKSGK--------------RVGKPSPKAASSPSNPAALPVASDSSPMGSKTKEPDSPGMP 1118

  Fly   598 -KQRQALLQRNLTEQHRM--QQDDEPPKNHTSPAMPPPSPQSNSSSSSSSSSSANTHSSQSSHAV 659
             |.:::::.|:.|:..::  .:...|.::......|...|.:|:...::...|:...........
  Rat  1119 GKDQRSMVLRSRTKPQQVFHAKRRRPSESRIPDCRPTKKPPANNHLPTAFKVSSGPQKEGRMSQR 1183

  Fly   660 NNIPKPEINNKATTDTPASPALVEQGDIDAKPA--------------VSVHECDEEEEPAV--NK 708
            ..:|||...:| .:|.|......:...:...||              |...|...|..|.:  ..
  Rat  1184 GKVPKPGTGSK-LSDRPLHTLKRKSAFMAPVPAKKRSLILRSNNGSGVDGREERAESSPGLLRRM 1247

  Fly   709 VSPAHPDPPTTAAVAAPPATESPKKSSPAANSESCPFGEVEDKLEQMFAG----IEEETERISSP 769
            .||....|..:.....||..|.|......|...|.| ..|..|:.....|    :|...::|:||
  Rat  1248 ASPQRARPRGSGEPPPPPPLEPPAACLGLATQSSLP-SAVRTKVLPPRKGRGLKLEAIVQKITSP 1311

  Fly   770 EKPAEESAAMVA---HNLTAQLALDPSKTLDTPAENQTSVLAVLAPNQTPT-----PEIRPVATK 826
              ..::.|..||   .......||...::..:||..:..|..:.|....|.     |..|..|:.
  Rat  1312 --GLKKLACRVAGAPPGTPRSPALPEKRSGGSPAGAEEGVGGMGAGQMLPAASGADPLCRNPASS 1374

  Fly   827 AAMK------------------------STMPSPVHSPIPQSRSTSTPLVAGDDSKSNTPVPAKA 867
            .::|                        .|:||...:..|:.||..        .::....|:|.
  Rat  1375 RSLKGKLLNSKKLSSAADCPKAEAFMSPETLPSLGTARAPKKRSRK--------GRTGALGPSKG 1431

  Fly   868 PAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRKKKVTKEPDFEDDD-----KPSTSAAAAAAL 927
            |..:||.|.:       :|:....|...:.:.|.          ||:.     ||.|.....|  
  Rat  1432 PLEKRPCPGQ-------ALILAPHDRASSTQGGG----------EDNSSGGGKKPKTEELGLA-- 1477

  Fly   928 AARQLSEAASATKSKPAAGAKKK------NAGVKGKKGSAGKGNAKNAKQ-NGKKSARKPAFTTD 985
                 |:.......:|...|:|:      ::..|.|:.|.|:|.|.:|.. .|:.:.|:......
  Rat  1478 -----SQPPEGRPCQPQTRAQKQPGQASYSSYSKRKRLSRGRGKATHASPCKGRATRRRQQQVLP 1537

  Fly   986 EDSTPAPTNGGGSVPELRFK-----------------SPFILI--------------------KP 1013
            .|  ||.       ||:|.|                 |||:.:                    ||
  Rat  1538 LD--PAE-------PEIRLKYISSCKRLRADSRTPAFSPFVRVEKRDAYTTICTVVNSPGDEPKP 1593

  Fly  1014 ---DGSVSIKNTHSAEDVNEKQTK------VKKAP----HERKNLRGMHSSTLSNRYDADTTDST 1065
               ..||:..:|.|:|......|.      ::..|    ....:|..:.|..||.        |.
  Rat  1594 HWKPSSVASSSTSSSEPAGASLTTFPGGSVLQLRPSLPLSSTMHLGPVVSKALST--------SC 1650

  Fly  1066 WICVFCKRGPHKLGLGDLFGPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQERNLP 1130
            .:|..|:...:...||||.|||.     .|:....:.|..::       |.|.|..:  :|.:||
  Rat  1651 LVCCLCQNPANFKDLGDLCGPYY-----PEHCLPKKKPKLKE-------KVRLEGTL--EEASLP 1701

  Fly  1131 ----------------AVPATLA-------NIMQAPKISMHKRKRKQTHDSSISYS--------- 1163
                            |.|.|..       ..:..|.......|:.....|:...|         
  Rat  1702 LERTLKGLECAASTTAATPTTTTITTTTTLGRLSRPDGPADPAKQGSLRTSARGLSRRLQSCYCC 1766

  Fly  1164 DDPNESRSQCSSVDLL---DCSTESKFVETFRGMGKTSENGFEVWLHEDCAVWSNDIHLIGAHVN 1225
            |...:...:.:..|..   :||.|:    .....|.|.|:    |:||.||||::.::|:...:.
  Rat  1767 DGQGDGGEEVAPADKSRKHECSKEA----PAEPGGDTQEH----WVHEACAVWTSGVYLVAGKLF 1823

  Fly  1226 GLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANWSLSEEDRKVYCHLHRHEPGV 1290
            ||..|:..:....|..|.::||:|.|....|....|.||......:..||:..:.|  .:|:.|.
  Rat  1824 GLQEAMKVAVDMPCTSCHESGATISCSYEGCTHTYHYPCANDTGCTFIEENFTLKC--PKHKVGE 1886

  Fly  1291 VEPIKTESIAPVEVSVATPPAPAP 1314
            ..|.:       :.|:..|.:|.|
  Rat  1887 QAPGR-------KYSLPNPVSPCP 1903

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 56/251 (22%)
Rai1XP_008766040.1 PHD_SF 1653..1882 CDD:304600 56/253 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112729238
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14955
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.