DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and G2e3

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001100196.1 Gene:G2e3 / 299002 RGDID:1310263 Length:717 Species:Rattus norvegicus


Alignment Length:167 Identity:43/167 - (25%)
Similarity:62/167 - (37%) Gaps:46/167 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1166 PNESRSQ----CSSVDLLDCSTESKFVETFRGMGKTSENGFEVW---LHEDCAVWSNDIHLIGAH 1223
            |..|:|.    |...|  ||  .:|:     |..||.|.    |   :|..|.:.|:.|...|..
  Rat     6 PGNSQSLACVFCRKND--DC--PNKY-----GEKKTCEK----WNFSVHYYCLLMSSGIWQRGKE 57

  Fly  1224 VNG--------LDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANWSLSEEDR-KV 1279
            ..|        :...|..:::.:|.:|::.||||.|....||.:.|:|||..........|. ..
  Rat    58 EEGVYGFLIEDIRKEVNRASKLKCTVCKKNGASIGCVVPQCKRSYHLPCGLQKECIFQFTDNFAS 122

  Fly  1280 YCHLHRHEPGV-----------------VEPIKTESI 1299
            :|..||....:                 ||||.|.:|
  Rat   123 FCWKHRPVQAITSNKYRDSLPCTICLEFVEPIPTYNI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 35/133 (26%)
G2e3NP_001100196.1 ePHD_PHF7_G2E3_like 14..127 CDD:277139 32/125 (26%)
PHD_PHF7_G2E3_like 232..285 CDD:276971
HECTc 365..688 CDD:421431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.