DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5098 and Phf11a

DIOPT Version :9

Sequence 1:NP_001261066.1 Gene:CG5098 / 37063 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_766191.1 Gene:Phf11a / 219131 MGIID:1918441 Length:293 Species:Mus musculus


Alignment Length:106 Identity:23/106 - (21%)
Similarity:44/106 - (41%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1207 HEDCAVWSNDIHLIGA----------HVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAH 1261
            ||:|.::|:.:....|          .|..:...:....|.:|..|:..||::....:.|....|
Mouse    51 HENCLLYSSGLVECEAPDLPNTVRNFDVKSVKKEIGRGRRLKCSFCKNKGATMGYDLQSCTKNYH 115

  Fly  1262 VPCGRSANWSLS-EEDR---KVYCHLHRHEPGVVEPIKTES 1298
            :.|....:..|. :||.   |::|  .:|.|...||.:.::
Mouse   116 LSCAMEDHAILQVDEDHGTYKLFC--QKHAPEGQEPTQRDA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 19/90 (21%)
Phf11aNP_766191.1 PHD_SF 28..142 CDD:304600 19/92 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.