DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and F01D4.5

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_501937.1 Gene:F01D4.5 WormBaseID:WBGene00008488 Length:223 Species:Caenorhabditis elegans

Alignment Length:381 Identity:78/382 (20%)
Similarity:110/382 (29%) Gaps:190/382 (50%)


  Fly   912 EDDDKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGKKGS-------AGKGNAK-- 967
            |.||..|||               .|..||.|     ||...||.||.:       ..|..|.  
 Worm     2 EIDDLESTS---------------NSVHKSPP-----KKRRRVKKKKRNEEDEEYEENKNMATQI 46

  Fly   968 NAKQNGK-KSARKPAFTTDEDSTPAPTNGGGSVPELRFKSPFILIKPDGSVSIKNTHSAEDVNEK 1031
            |.|...| ||.||       |.||        :.|:|          :|...|||:         
 Worm    47 NQKFGSKYKSNRK-------DETP--------MFEVR----------NGKSVIKNS--------- 77

  Fly  1032 QTKVKKAPHERKNLRGMHSSTLSNRYD------------ADTTDSTWICVFCKRGPHKLGLGDLF 1084
                           |.|.:|::...|            :|..:|:::|..|.....|   .:||
 Worm    78 ---------------GNHEATVNRTLDFHMTKLFQWEEQSDAIESSYVCALCHENGEK---RELF 124

  Fly  1085 GPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATLANIMQAPKISMHK 1149
            |||..|.:..:|                                   .|:.||....|.|     
 Worm   125 GPYYATHNPIKY-----------------------------------WPSFLAKKPTAKK----- 149

  Fly  1150 RKRKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSENGFEVWLHEDCAVWS 1214
                            |.:                                 .|:|.|..|.:|:
 Worm   150 ----------------PTK---------------------------------IELWFHGSCVLWA 165

  Fly  1215 NDIHLIGAHVNGLDAAV---WDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRS 1267
            .::||.|..:..||..:   |..|   |::|::|||:| ..|.......|.||.::
 Worm   166 PNVHLHGNQLTNLDNQIDIFWSQT---CIVCRKTGAAI-SVQNKKNTFIHYPCAKN 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 38/204 (19%)
F01D4.5NP_501937.1 PHD_SF 111..218 CDD:304600 38/204 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003562
OrthoInspector 1 1.000 T475614
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.